RetrogeneDB ID:
retro_mputfur_1285
Organism:
Location:
GL897067.1:15979-16333 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
80.51 %
Coverage:
74.21 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PIN4
Parental gene aliases:
No gene alias available
Parental gene description:
protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin) [Source:HGNC Symbol;Acc:8992]

Genomic region (view in browser)





>retro_mputfur_1285
AGAGGGTAAGGGGGAGCAGCCGCCTCTGGGAGTGACAGTTCGGACAAGAAGGCTCAGGGT
CCCAAAGGTGGTGGCCATATAGCAAAGGTCAGACACATTCTGTGTGAGGAACATGAGAAA
ATCAAGCAGGCCATGGCAAAGTTAAAGTCTGGAATAACTTTCAATGAAGTGGCCACACAT
TATAGTGAAGATAAAGCCAGGCAAGGGTGCGACCTGGGCTGGATGACCAGAGGTTCCACG
GTGGGACTATTTCAAGAAGCAGCATTTGCCCTGCCTGTAAGAGGGCTGGTTAAGCCTGTG
TTTACAGACCCTCCGGTTAAGACAAAATTTGGGTATCATACTATAATGGTGAAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGGKGGAASGSDSSDKKAQGPKGGGSAIKVRHILCEKHGKIMEAMEKLKSGMRFNEVATQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPISGLDKPV
.G..G.AASGSDSSDKKAQGPKGGG...KVRHILCE.H.KI..AM.KLKSG..FNEVAT.YSEDKARQG.DLGWMTRGS.VG.FQEAAFALP..GL.KPV
Retrocopy
RG*GGAAASGSDSSDKKAQGPKGGGHIAKVRHILCEEHEKIKQAMAKLKSGITFNEVATHYSEDKARQGCDLGWMTRGSTVGLFQEAAFALPVRGLVKPV


Parental protein
FTDPPVKTKFGYHIIMVE
FTDPPVKTKFGYH.IMV.
Retrocopy
FTDPPVKTKFGYHTIMVK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide