RetrogeneDB ID:
retro_mputfur_1286
Organism:
Location:
GL897068.1:1701597-1702312 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
70.61 %
Coverage:
52.85 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
ADSS
Parental gene aliases:
No gene alias available
Parental gene description:
adenylosuccinate synthase [Source:HGNC Symbol;Acc:292]

Genomic region (view in browser)





>retro_mputfur_1286
AAATTACAAAACCTCAAGGGCTATATGGAAAGGATTAAACCAATGGTGAGAGATGGTTTC
CTCTCCGAGGTCCTGCATGGACCACCAAAGAAAATCTTGGTACAAGATGCCAATGCAGAA
CTACTAGATAGTAATTTTAGGACTTATCCTTTTGTAACCTCTTCAAACTGTACAGTGGGA
GGTGTCTGTACCTGATTGGGTATACTTTCCCAAAATGCTGGAGAAGTGATGGGGTCCTAA
AAGCATACAAAACTCAAGTTGGCACTGGTGACTTCACTACAGAGTAAGACAATGAAAGTG
GAGAATTAATACAAAAAGAGGTGGAGGGTTTGGGGTAGCCACTGGAAGGAGAAAAAGATG
GGTCTGGCTGGACCTCATCTCGCTCAAATGTGCTCAAATGATTAATGAATTTCCTGTGTT
GGCACTTAAAAGAATAGATATTTTGGACACATTTACAGAAATCAAATTTGGAGTTGCTTA
CAAGGTAGATGGTGAAATCCTTCCTCATTTCCCAGGAAACCAAGAAATCTTAAATAAATC
TTAAAGCTCAGTATAAGGCTCTCCCAGGTTGGAACATAGATAATCGAATGCAAGGATATT
TGAAGAACTACCTGTTAAGGCCCAAAATTACATTCATTTTATTGAAGAAGAGCTTCAAGT
TCCAGTTAAATGGATTGGTAGAGGTAAATCCAGAGAGTTTATGATTCGATTCTTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ELQKLKGYMERIKPMVRDGVYFLYEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYG-VVKAYTTRVGIGAFPTEQD
.LQ.LKGYMERIKPMVRDG..FL.E.LHGPPKKILV..ANA.LLD..F.TYPFVTSSNCTVGGVCT.LG...QN.GEV.G.V.KAY.T.VG.G.F.TE.D
Retrocopy
KLQNLKGYMERIKPMVRDG--FLSEVLHGPPKKILVQDANAELLDSNFRTYPFVTSSNCTVGGVCT*LGILSQNAGEVMG/VLKAYKTQVGTGDFTTE*D


Parental protein
NEIGELLQT-RGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHFPANQEVLNK-VEVQYKTLPGWNTDI
NE.GEL.Q..RG..FGV.TGR..R..WLDL..LK.A.MIN.F..LAL...DILD.FTEIK.GVAYK.DGEI.PHFP.NQE.LNK....QYK.LPGWN.D.
Retrocopy
NESGELIQK/RGGGFGVATGRRKRWVWLDLISLKCAQMINEFPVLALKRIDILDTFTEIKFGVAYKVDGEILPHFPGNQEILNK\LKAQYKALPGWNIDN


Parental protein
-SNARTFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQLF
.SNAR.F.ELPV.AQNY..FIE.ELQ.PVKWIG.GKSRE.MI..F
Retrocopy
/SNARIFEELPVKAQNYIHFIEEELQVPVKWIGRGKSREFMIRFF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide