RetrogeneDB ID:
retro_mputfur_1288
Organism:
Location:
GL897069.1:2198891-2199254 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
74.4 %
Coverage:
98.4 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS25
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S25 [Source:HGNC Symbol;Acc:10413]

Genomic region (view in browser)





>retro_mputfur_1288
CCCAAAGGCAACAAGAAGAGGAAATATGACAGAAAGTCAAAGCCAAAAAGACAAAGACCC
AGTGAACAAATCTTGGGGCAAAGTCAAAAGAAGAAAGTGGTCCAAAGGCAAAGTTGGGGA
CAAGCTCAATAGCCTGGTCTTGTTTAACAAAGCAACAAAACTCTATAAGGAAATTCCCAA
CTACAAGCTTATAACCCTAGCTTTGTTTCTGAGAGACTAAGGATTCAAGGTCCTCTGGCC
AGGGCAGACCTTCAGGAGTTCCTTAGTAAAGGACTTATTAAACTGATTTCAAAGCACAGA
GCTCAAGTAATTTACACCAGAAGCACCAAGAGTAGAGATGCCCCAGCTGCCGGTGAAGAT
GCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PKDDKKKKDAGKS-AKKDKDPVNKSGGKAKKKKWSKGKVRDKLNNLVLFDKATYDKLCKEVPNYKLIT-PAVVSERLKIRGSLARAALQELLSKGLIKLV
PK..KK.K...KS...KDKDPVNKS.GK.K..KWSKGKV.DKLN.LVLF.KAT..KL.KE.PNYKLIT.P..VSERL.I.G.LARA.LQE.LSKGLIKL.
Retrocopy
PKGNKKRKYDRKS\SQKDKDPVNKSWGKVKRRKWSKGKVGDKLNSLVLFNKAT--KLYKEIPNYKLIT/PSFVSERLRIQGPLARADLQEFLSKGLIKLI


Parental protein
SKHRAQVIYTRNTKGGDAPAAGEDA
SKHRAQVIYTR.TK..DAPAAGEDA
Retrocopy
SKHRAQVIYTRSTKSRDAPAAGEDA


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide