RetrogeneDB ID:
retro_mputfur_1290
Organism:
Location:
GL897070.1:2043477-2043843 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
96.72 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
GABARAP
Parental gene aliases:
No gene alias available
Parental gene description:
GABA(A) receptor-associated protein [Source:HGNC Symbol;Acc:4067]

Genomic region (view in browser)





>retro_mputfur_1290
ATGAAGTTCGTGTATAAAGAGGAGCATCCGTTCGAGAAACGCCGCTCTGAGGGCGAGAAG
ATCCGAAAGAAATACCCGGACCGGGTTCCGGTGATAGTAGAAAAGGCTCCCAAAGCTCGG
ATAGGAGACCTGGACAAAAAGAAATGCCCGGTGCCTTCTGATCTCACAGTTGGTCAGTTC
TACTTCTTGATCCGGAAGCGAATTCATCTCTGAGCTGAGGATGCCTCGTTTTTCTTTGTC
AACAATGTCATTCCACCCACCAGTGCCACAATGGGTCAGCTATACCAGGAGCACCACGAA
GAAGACTTCTTTCTGTACATCGCCTACAGTGATGAAAGTGTCTACGGTCTGCGAAGCTGC
TGCCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHE
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKK..VPSDLTVGQFYFLIRKRIHL.AEDA.FFFVNNVIPPTSATMGQLYQEHHE
Retrocopy
MKFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKCPVPSDLTVGQFYFLIRKRIHL*AEDASFFFVNNVIPPTSATMGQLYQEHHE


Parental protein
EDFFLYIAYSDESVYGLRSCCP
EDFFLYIAYSDESVYGLRSCCP
Retrocopy
EDFFLYIAYSDESVYGLRSCCP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide