RetrogeneDB ID:
retro_mputfur_1293
Organism:
Location:
GL897070.1:359976-360768 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
95.08 %
Coverage:
100.0 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS3A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S3A [Source:HGNC Symbol;Acc:10421]

Genomic region (view in browser)





>retro_mputfur_1293
ATGGTGGTCAGCAAGAACAAGCGCCTTACAAAAGGCGGCAAAAAGGGAGCCAAGAAGAAA
GTGGTTGATCCATTTTCTAAGAAAGATTGGTATGATGTGAAAGCACCAGCTATGTTCAAT
ATAAGAAATATTGGAAAAACATTAGTCACAAGAACTCAAGGAACCAAAATCGCTTCTGAT
GGCCTCAAGGGTCGTGTATTTGAAGTGAGTCTTGCTGATCTGCAGAATGATCAAGTTGCA
TTTAGAAAATTCAAGCTAATTATTGAGGATGTCCAGGGCAAAAACTGCCTGACCAATTTC
CATGACATGGATCTTACCCGGGACAAAATGTGCTCCATGGTCAAAAAATGGCAGACCATG
ATTGAAGCTCATGTTGATGTCAAGACTACCGATGGTTATTTGCTTCATCTATTTTGTGTT
GGTTTTACTAAAAAACGCAATAATCAGATTCAGAAGACCTCTTACGTTCAGCATCAACAG
GTCCGCCAAATTCGGAAAAAGATGATGGAGATCATGACCTGAGAGGTTCAGACAAATGAC
TTGAAAGAAGTGGTCAATAAATTGATTCTAGACAGCATTGGAAAAGATATAGAAAAAGCT
TGTCAGTCTATTTAACCACTCCATGATGTCTTCGTTAGAAAAGTAAAAATGCTGAAGAAG
CCCAAGTTTGAATTGGGAAAGCTCATGGAGCTTCATGGTGAAAGTAGTAGTTCTGGAAAA
GCTACTGGGGATGAGACCGGTGCTAAAGTGGAACGAGCTGATGGATATGAGCCACCAGTC
CAGAAATCTGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAVGKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDEVAFRKFKLITEDVQGKNCLTNF
M.V.KNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQND.VAFRKFKLI.EDVQGKNCLTNF
Retrocopy
MVVSKNKRLTKGGKKGAKKKVVDPFSKKDWYDVKAPAMFNIRNIGKTLVTRTQGTKIASDGLKGRVFEVSLADLQNDQVAFRKFKLIIEDVQGKNCLTNF


Parental protein
HGMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLRLFCVGFTKKRNNQIRKTSYAQHQQVRQIRKKMMEIMTREVQTNDLKEVVNKLIPDSIGKDIEKA
H.MDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLL.LFCVGFTKKRNNQI.KTSY.QHQQVRQIRKKMMEIMT.EVQTNDLKEVVNKLI.DSIGKDIEKA
Retrocopy
HDMDLTRDKMCSMVKKWQTMIEAHVDVKTTDGYLLHLFCVGFTKKRNNQIQKTSYVQHQQVRQIRKKMMEIMT*EVQTNDLKEVVNKLILDSIGKDIEKA


Parental protein
CQSIYPLHDVFVRKVKMLKKPKFELGKLMELHGEGSSSGKATGDETGAKVERADGYEPPVQESV
CQSI.PLHDVFVRKVKMLKKPKFELGKLMELHGE.SSSGKATGDETGAKVERADGYEPPVQ.SV
Retrocopy
CQSI*PLHDVFVRKVKMLKKPKFELGKLMELHGESSSSGKATGDETGAKVERADGYEPPVQKSV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide