RetrogeneDB ID:
retro_mputfur_1294
Organism:
Location:
GL897071.1:738016-738711 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
69.71 %
Coverage:
79.0 %
Frameshifts:
4
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1294
ATAATCCTGCTGGAGGTGAGCAATGACATCATTGAGGTCACACGCAAGTTAAAAAATGTG
GCCGCTGGTCACAAACCAGAAGCAGTAGAAGTAAAACTTGCAGATTTTGTTGGGAGTCCT
CTATCATATTTCAAATCCCAATGGAGAAAAAAAAAAGTGATGGTCAGTGTTTCTTTGAAA
TTCTACAAGGAACTTCAGGCACGGGATACTGATGAGTTAATAAAGAGGATGTACAGAGTT
TTCTTGGTAAATCACAAACCAGGATACAATGTCTCTTTGCTATATGACCTTGATAATCTT
GCCGGCATCCAAGGATTCCATTGGGCATCAGGCTGGCATGTTGACATTAAATTGTTTTGC
CTCTGTCTTTGAGAAATGCTTCTAATCCCAAGATGAGGGCAGAGAAGGAGAGAACGGTGC
ATTTATCTGTTAGAGGAATGGTGAGACCATGTATGTTTAGTCTAAAAAGGATAGCGTCAC
AGTAGTCTTCAGTACAGTGTTTACGGATAACGATGATGTAGTGATTGGAAAAGTGTCCAT
GCAAGAGTTCAAACAAGGACACACAGCCCCCATAGTTCCCCCTTAGCCACCGGGAACCTC
CTCTGGAGCTGAAAGACACAGATGCTGCAGCAGGTGACAACACTGGCTCTATAACCTTCA
TTCCCTCACCACACCGAGGCCAGGGCTCGAGAAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDG-VLYHISNPNGDKTK-VMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYD
.ILLEV.N.IIE.T..LK..N.AAG.KPEAVEV..ADF.G.VLYHISNPNG.....VMVS.SLKFYKELQA...DEL.KR.Y..FLVN...GYNVSLLYD
Retrocopy
IILLEVSNDIIEVTRKLK--NVAAGHKPEAVEVKLADFVG\VLYHISNPNGXXXX/VMVSVSLKFYKELQARDTDELIKRMYRVFLVNHKPGYNVSLLYD


Parental protein
LENL-PASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQ
L.NL.PASKDSI.HQAGML..NCFASVFEK.F..Q.EG.EGEN.A.I..R..ETMYV.SKKD.VTVVFSTVF.D.DDVVIGKV.MQEFK.G....HTAP.
Retrocopy
LDNL\PASKDSIGHQAGMLTLNCFASVFEKCF*SQDEGREGENGAFIC*RNGETMYV*SKKDSVTVVFSTVFTDNDDVVIGKVSMQEFKQG----HTAPI


Parental protein
V-LFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASAR
V...SHREPPLELKDTDAA.GDN.G.ITF...P.....S..
Retrocopy
V\PLSHREPPLELKDTDAAAGDNTGSITFIPSPHRGQGSRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide