RetrogeneDB ID:
retro_mputfur_1297
Organism:
Location:
GL897071.1:137893-138683 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.96 %
Coverage:
58.41 %
Frameshifts:
6
Stop codons:
6


Parental gene:
Parental gene symbol:
ILK
Parental gene aliases:
No gene alias available
Parental gene description:
integrin-linked kinase [Source:HGNC Symbol;Acc:6040]

Genomic region (view in browser)





>retro_mputfur_1297
ATGGATGACATTTTCACCCAGTGGTGGGAGGGCAATGTGGTGGCCATTCACCTGTAAGCT
GGACAACACGAAAACAGCCTCAACCAGGAGATGATCATGGCTTCTCCCCCTTGCCCTGGC
CTGCCAAGAGGGCTGTTGTCCTGTGGTTGAGATGCTGATCATGTGGGGAACATGAATCAA
TGTGATGAACCATGGTGATGAACCCCCTAGCACCTGGCAGCTGGTCCCAGACACCGTGAT
ATTGTGCAGAAGCTGCAGCAGTATAAAGCTGACATCAATGCAGTGAATGTACATAGAAAT
GTGCCCCTGCATTATGCCTGTTTTTTTGGGCCAACATCGGGTTGCAGAGGACATGGTGGC
TAATGGGGCTCTTTGTCAGCATTTATAACAAGTATGGAGAGATGTCCAAGGACAAAGCCA
AGGACCTCTGAGGGATCTCTTCTGAGAGCAGGCAGAGAAGATGGGCCACAACTTTAACCA
TATTTCATACAAGGACACATTTTGGAAAATAACCACCCGCATTTGGCCCGAGAATGGGAC
TCTGCACAAACATGCTGGCACTGACTTCAAACAGCTCAACTTTCTGGCAAAATTCAATGA
CCATCACTCTGGAGAGCTATGTAAGGGCTGTTGACAGGTCAATGACATTGTCATGAAGAT
GCTAAAGGTTTGAAACTGGAGTACAAGGAAGAGCAGGGACTTTAATGAGGAATGTCCCCA
TCTAAGGATTTTCTCGCATCCAGATGTTCTCCCTGTGCTAGGTGCTCGTCAGTCTCTACC
TTCTCCTCAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDDIFTQCREGNAVAVRLWLDNTENDLNQ-GDDHGFSPLHW-ACREGRSAVVEMLIMRGARINVMNRGDD-TPLHLAASHGHRDIVQKLLQYKADINAVN
MDDIFTQ..EGN.VA..L.....EN.LNQ.GDDHGFSPL.W.AC.EG...VVEMLIM.G..INVMN.GD..TP.HLAA...HRDIVQKL.QYKADINAVN
Retrocopy
MDDIFTQWWEGNVVAIHL*AGQHENSLNQ/GDDHGFSPLPW/ACQEGCCPVVEMLIMWGT*INVMNHGDE/TP*HLAAGPRHRDIVQKLQQYKADINAVN


Parental protein
EHGNVPLHYACFWG-QDQVAEDLVANGAL-VSICNKYGEMPVDKAK-APLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDYKQLN
.H.NVPLHYACF.G.Q..VAED.VANGAL.VSI.NKYGEM..DKAK..PLR.L..E.AEKMG.N.N.I.YKDTFWK.TTR..P.NGTL.KH.G.D.KQLN
Retrocopy
VHRNVPLHYACFFG\QHRVAEDMVANGAL\VSIYNKYGEMSKDKAK/GPLRDLF*EQAEKMGHNFNHISYKDTFWKITTRIWPENGTLHKHAGTDFKQLN


Parental protein
FLAKLNENHSGELWKGCWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPH
FLAK.N..HSGEL.KGC.Q.NDIV.K.LKV..WSTRKSRDFNEECP.LRIFSHP.VLPVLGA.QS.P.PH
Retrocopy
FLAKFNDHHSGELCKGC*QVNDIVMKMLKV*NWSTRKSRDFNEECPHLRIFSHPDVLPVLGARQSLPSPH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide