RetrogeneDB ID:
retro_mputfur_1298
Organism:
Location:
GL897071.1:183432-183861 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
85.52 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
RPS23
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S23 [Source:HGNC Symbol;Acc:10410]

Genomic region (view in browser)





>retro_mputfur_1298
ATGGGCAAGTGTCGCAGTCTCCTTACTGACAGGAAGCTCCACAGCCACCGACGAGATCAG
AAGTGGCATGATAAACCGTACAAGAAAGCCCTTGTGGGCACAGCCCTGAAGGCCAGCCCT
TTTGGAGGCACGTCCCAGGCAAAAGGAATTGTGTTGGAAAAAGTAGGGGTTGAAGCCAAG
CAGCCAAATTCTGCCATCAGGAAGTGTGTCAGGGTCCAGCTGATCAAGAATGGCAAAAAA
ATCACAGCCTTTGTACCCAAGGATGGTTGTTTGATTTTTATGAGGAAAATGATGAGGTTC
TGGTTGCTGGATTTGGTCACAAAGGTTATGCTGTCAGTGACATTCCTGGAGTTTGCTTTA
AGGTTATCAAAAGTAGCCAATGTCTCTCTTTTGGCCTTATACAAAGGCAAGAAGGAAAGA
CGAAGATCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MGKCRGLRTARKLRSHRRDQKWHDKQYKKAHLGTALKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPNDGCL-NFIEENDE
MGKCR.L.T.RKL.SHRRDQKWHDK.YKKA..GTALKA.PFGG.S.AKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVP.DGCL..F.EENDE
Retrocopy
MGKCRSLLTDRKLHSHRRDQKWHDKPYKKALVGTALKASPFGGTSQAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPKDGCL/DFYEENDE


Parental protein
VLVAGFGRKGHAVGDIPGVRFKVV-KVANVSLLALYKGKKERPRS
VLVAGFG.KG.AV.DIPGV.FKV..KVANVSLLALYKGKKER.RS
Retrocopy
VLVAGFGHKGYAVSDIPGVCFKVI\KVANVSLLALYKGKKERRRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide