RetrogeneDB ID:
retro_mputfur_1300
Organism:
Location:
GL897073.1:2066601-2067529 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
78.98 %
Coverage:
93.41 %
Frameshifts:
2
Stop codons:
0


Parental gene:
Parental gene symbol:
Ldhb
Parental gene aliases:
No gene alias available
Parental gene description:
lactate dehydrogenase B [Source:MGI Symbol;Acc:MGI:96763]

Genomic region (view in browser)





>retro_mputfur_1300
AAACAAACTGTAGCGGGCATTGGACAAGTTGGTATGGCGTGTGCCATCAGCATTCTAGAA
AAGTCTCTGGCTGATGAGCTTGCCCTTATAGATGTTTTGGAAGATAAAGGCAAAATGATG
GATCTGCAACATGAGAGCTTATTTCTTCAGACACCTAAAATTGTGGCAGATAAAGATTAC
TCTGTGATTGCCAATTCTAAGATTATAGCGGTGACCGCAGGAGTCCATCAGCAGGAGAGC
AAGAGCTGTCTCAATCTGGTGCAGAGGAATTTTAATGTCTTCAAATTCGTTATTCCCCAG
ATAGTCAAGTACAGTCCTGATTGTATCATAATTGTGGTTTCCAACCCAGTGGATATTCTC
ACATATGTTACCCGGAATCTAAGTGGGCTACCCAAGCACCATGTCATTGGAAGTGGGTGT
AATCTGGGTTCTGCTAGATTTCACTATCTTATCCCTGAAAAACTTGTCATTCATTCCAGA
AGCTACCATCAATGGATTTGGGGAGAACATGGGGATTCAAATGTGGCTGCATGGAGTGGA
GTCAATGTGGCAGGCATTTCTCTCGGGAACTGAATCCAGAAATGGGAACAGGCAATGACA
GTGAAAATCGTAAGGAAGTGGAGAAGATGGTGGTTAAAAGTGCCTATGACATCATGAAGC
TAAAAGGATGTACCAACTGGGGTGTTGGATTGAATGTGGCTGATATCATTGAATCCATGT
TGGAAAATCTATCCAGGATTCATCCAGTGTCAGTGATGGTAAAGGGAATATACAGCATGG
AGAATGAAATCTTCCTGAGCCTTCCATGTTTCCTGAAGTGTCAGGGATTAATCAATATGA
TCAAAAGAAGCTGAAGGACGACGAGGTTGCTCAGCTGAAAAAAAGTGCACATACCTTGTG
GGACATCCAGAAAGACCTAAAAGACTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFII
K.TV.G.GQVGMACAISIL.KSLADELAL.DVLEDK..G.MMDLQH.SLFLQTPKIVADKDYSV.ANSKI..VTAGV.QQE..S.LNLVQRN.NVFKF.I
Retrocopy
KQTVAGIGQVGMACAISILEKSLADELALIDVLEDK--GKMMDLQHESLFLQTPKIVADKDYSVIANSKIIAVTAGVHQQESKSCLNLVQRNFNVFKFVI


Parental protein
PQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSL-QELNPDMGT
PQIVKYSPDCIIIVVSNPVDILTYVT..LSGLPKH.VIGSGCNL.SARF.YL..EKL.IH..S.H.WI.GEHGDS.VA.WSGVNVAG.SL..ELNP.MGT
Retrocopy
PQIVKYSPDCIIIVVSNPVDILTYVTRNLSGLPKHHVIGSGCNLGSARFHYLIPEKLVIHSRSYHQWIWGEHGDSNVAAWSGVNVAGISL/RELNPEMGT


Parental protein
DNDSENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARGLTSVI-NQKLKDDEVAQLKKS
.NDSEN.KEV.KMVV.SAY...KLKG.TNW..GL.VAD.IESML.NLSRIHPVS.MVKG.Y..ENE.FLSLPC.L...GL...I...KLKDDEVAQLKKS
Retrocopy
GNDSENRKEVEKMVVKSAYDIMKLKGCTNWGVGLNVADIIESMLENLSRIHPVSVMVKGIYSMENEIFLSLPCFLKCQGLINMI/QKKLKDDEVAQLKKS


Parental protein
ADTLWDIQKDLKDL
A.TLWDIQKDLKDL
Retrocopy
AHTLWDIQKDLKDL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide