RetrogeneDB ID:
retro_mputfur_1302
Organism:
Location:
GL897074.1:376716-377176 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
52.2 %
Coverage:
69.64 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
CHMP4B
Parental gene aliases:
No gene alias available
Parental gene description:
charged multivesicular body protein 4B [Source:HGNC Symbol;Acc:16171]

Genomic region (view in browser)





>retro_mputfur_1302
GAGGAGACGATTGCCACTAAAAACCACAGCACCAAAAACAAGTACACAACTCTTTGGTCA
CTAAAGCCCAAGAAGAGGCATAAAAAGCCACTGGTGCCTGTCAAGCGCACACGAAGACCA
TCGAAATTTCAGTGAGAGGCCCTGGAGATCATCAGTAGTGACACCAATAGGCTCAAGAAC
ATGGACTATTCGGCCAAGGCCATGAAGGCTGCCTACAACACCACAAACATGGATAACATT
GGGGAGTTAATGCAGGGCATTGCTGACTTGTAGGAGATTTCAGCAGTGATTTCAAAACCT
GGAAGATCTGGAGAAGAGCTGGACGAAGATGAGCTCCTGGCAGAATTAGCACTAGAACAG
GAGGAACTAGACAAGAATGTGCTGAGAATTAGCGGGCGAAATTAGTGAAACAGTCCTTTT
CCCAAATGTTCCCTCTATAATCCCACCTGCCTGCACCACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QELTAAKKHGTKNKRAALQALKRKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAHDNMDIDKVDELMQDIADQQELAEEISTA
.E..A.K.H.TKNK...L..LK.KKR..K.L.....T.....FQ.EALE.....T..LKNM.Y.AKAMKAA......D...ELMQ.IAD..E.....S..
Retrocopy
EETIATKNHSTKNKYTTLWSLKPKKRHKKPLVPVKRTRRPSKFQ*EALEIISSDTNRLKNMDYSAKAMKAAYNTTNMDNIGELMQGIADL*EI----SAV


Parental protein
ISKPVGFGEEFDEDELMAELEELEQEELDKNLLEISGPE--TVPLP-NVPSITLPSKPT
ISKP...GEE.DEDEL.AEL..LEQEELDKN.L.ISG......P.P.NVPSI..P...T
Retrocopy
ISKPGRSGEELDEDELLAEL-ALEQEELDKNVLRISGRN**NSPFP\NVPSIIPPACTT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide