RetrogeneDB ID:
retro_mputfur_1316
Organism:
Location:
GL897079.1:188201-188693 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.17 %
Coverage:
98.22 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
RPS5
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S5 [Source:HGNC Symbol;Acc:10426]

Genomic region (view in browser)





>retro_mputfur_1316
CAGGATTACAGAGCCATGAAAGAGAAGGATGCCAAGTACCTGTCCCCCAGTGCAAGGTGC
TAGGTGGCCAAACGCTTCAACAAGGTGCATCGCCCTGCTGTGGAACACCGTACCAATGCA
ATGGTCATACACTGCCTTAAAAACAGCAAGCAGCTCATGACCATGCCACTGCCAAGCATG
CCTTTGAGATCGTCCATCCGCTTACTGGTGAGAACACCCTGTAGGTCCTGGTCCATGCCA
TTATCAACAGCAGTTCTGGAAGGACTCAATCTGGATCGGGCAATCCTGAACAGGGAGGGG
TCAGGGCATTCATGTGTCCCCACTATGCCATGTGAATTAAGGTGTTTGGCTGCTGTGCAC
AGGTGCCTGTGGGGTCGCCTTCCAGAATATCAAGACCACTGCTGAGGGTCTAGCACATGA
GCTTATCAGGCAACCAAAGGCTCTTCCAATTCCTATGCTACCAAGAAGGATGAGCTGGGA
AGTAGAGCCAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QDYIAVKEKYAKYLPHSAGRYAAKRFRKAQCPIVERLTNSMMMHGRNNGKKLMTVRI-VKHAFEIIHLLTGENPLQVLVNAIINSGPR-EDSTRIGRAGT
QDY.A.KEK.AKYL..SA....AKRF.K...P.VE..TN.M..H...N.K.LMT.....KHAFEI.H.LTGEN.L.VLV.AIINS.....DS..IG...T
Retrocopy
QDYRAMKEKDAKYLSPSARC*VAKRFNKVHRPAVEHRTNAMVIHCLKNSKQLMTMPL/AKHAFEIVHPLTGENTL*VLVHAIINSSSG/KDSIWIGQS*T


Parental protein
VRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECLADELI-NAAKGSSNSYAIKKKDELERVAK
.R.Q...VSPL..VN...WLLCTGA...AF.NIKT.AE.LA.ELI..A.KGSSNSYA..KKDEL...AK
Retrocopy
GRGQGIHVSPLCHVN*GVWLLCTGACGVAFQNIKTTAEGLAHELI/QATKGSSNSYA-TKKDELGSRAK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide