RetrogeneDB ID:
retro_mputfur_1317
Organism:
Location:
GL897079.1:1806461-1806906 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.62 %
Coverage:
67.58 %
Frameshifts:
2
Stop codons:
5


Parental gene:
Parental gene symbol:
HPRT1
Parental gene aliases:
No gene alias available
Parental gene description:
hypoxanthine phosphoribosyltransferase 1 [Source:HGNC Symbol;Acc:5157]

Genomic region (view in browser)





>retro_mputfur_1317
CAGGGGAGCTATAAATTCTCTACTGACTTGCTGGATTATGACAAAGCACTGAACAGAAAT
AGTAATATATCCATCCCCTGACTGCAGATTTTATGAGATGGAAGAGCTATGGTAATGACC
ATTCAGTTGGAGCAATAAAATAAATTTATGGAGATGATTTTGCAACTTCAACTGGATAGA
ATGTCTTGGTTGCTATAGACACAACTGGCATTGGCAAAACAATGCAAATCTTGCTTTCCT
GAGTCAAGCCATATAATTCAAAGATGGTCACCATATTGCCAGTTTAATGATGAAAACGCT
CCCCAAAACTCTTGGATATAGACTGCACTGTGTTGGGTATGAAATTCCTGGCTGATTTGT
TGGAGAATGTGTCCTTGACTATAATTAAAACATCAAGGATTTAAGTCATGTTTGTGTCAT
TAGCAAAACTGGAAAAGCCAAATAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KGGYKFFADLLDYIKALNRNSDGSIP-MTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVEDIIDTGKTMQTLLSLVKEHNPKMVKVASL-LVK
.G.YKF..DLLDY.KALNRNS..SIP..T.DF.R.KSY.ND.S.G.IK.I.GDD..T.TG.NVL...D....GKTMQ.LLS.VK..N.KMV......L..
Retrocopy
QGSYKFSTDLLDYDKALNRNSNISIP/LTADFMRWKSYGNDHSVGAIK*IYGDDFATSTG*NVLVAIDTTGIGKTMQILLS*VKPYNSKMVTILPV/LMM


Parental protein
RT-PRSVGYKPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKY
.T.P...GY....VG.EIP..FV....LDYN....DL.HVCVIS.TGKAKY
Retrocopy
KTLPKTLGYRLHCVGYEIPG*FVGECVLDYN*NIKDLSHVCVISKTGKAKY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide