RetrogeneDB ID:
retro_mputfur_1321
Organism:
Location:
GL897081.1:40504-40854 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
80.51 %
Coverage:
56.8 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
BTF3
Parental gene aliases:
No gene alias available
Parental gene description:
basic transcription factor 3 [Source:HGNC Symbol;Acc:1125]

Genomic region (view in browser)





>retro_mputfur_1321
TTCTCCTTAAAGAAGTTAGGAGTAAACAACACCTCTGATATTGAAGAAGTGCATATGTTC
ACAAACCAAGGAATAGAGATACACTTTAACAACCCAAAAGTTCAGGCATTGCTGGCCATG
AACACTTTCACCATTACAGGCTATGCTGAGACAAACAGCTGACAAAAATGCTACCCAGCA
TCTTCAACCAACTTGTTGCAGACAGTTCAACCAGTTTAAGAAGACTAGTGGAAGCTCTGC
CCAAATAATCCGTGGGTGGAAAAGCCCCAGTTGCTACTGGAGAGAATGATGATGATAAAA
TTCCAGAACTTGTGGAGCATTTTGATGAGCCTTCCAAGAATGAAGCGAAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
FSLKKLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAET-KQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDD
FSLKKLGVNN.S.IEEV.MFTNQG..IHFNNPKVQA.LA.NTFTITG.AET.KQLT.MLPSI.NQL.ADS.TSLRRL.EALPK.SV.GKAP.ATGE.DDD
Retrocopy
FSLKKLGVNNTSDIEEVHMFTNQGIEIHFNNPKVQALLAMNTFTITGYAET/KQLTKMLPSIFNQLVADSSTSLRRLVEALPK*SVGGKAPVATGENDDD


Parental protein
EVPDLVENFDEASKNEAN
..P.LVE.FDE.SKNEAN
Retrocopy
KIPELVEHFDEPSKNEAN


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide