RetrogeneDB ID:
retro_mputfur_1322
Organism:
Location:
GL897081.1:621910-622243 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.5 %
Coverage:
97.37 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
Tmem14c
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 14C [Source:MGI Symbol;Acc:MGI:1913404]

Genomic region (view in browser)





>retro_mputfur_1322
ATGCAGAAGGCCTCTGCCTCTCTAGTGCCTTTACACTGGGTTGGCCTTGGCTGTGCAACG
CTGATTGTTGCTTCTGGTGGGATCAGTGGCTGTGCAAAATCTAGTGCCCTATCAGTGGCT
GCTGGGCTTCTTTTCTGTGGCGTATCAAGCCTGGGTGCTTATCAGCTCTCTCAGGATCCA
ATGAACATTTGGGTTTTCCTAGCTATATCTGGAACCTTAAATGGCATTATAGGACTGAGA
TTCCATTACTCTGGATGGATTAGGCCTGTGGTCTTAAACTTGAGTGCCAGTTTGTTGACG
GTCACCAAATTTGGAATTAGTGTGTTGAATAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MQKDSGPLVPLHWIGFGYAAL-VASGGIIGYAKAGSVPSLAAGLLFGSLAGLGAYQLSQDPRNIWVFLATSGTLAGIMGMRFYHSGKFMPAGLIAGASLL
MQK.S..LVPLHW.G.G.A.L.VASGGI.G.AK.....S.AAGLLF.....LGAYQLSQDP.NIWVFLA.SGTL.GI.G.RF..SG...P..L...ASLL
Retrocopy
MQKASASLVPLHWVGLGCATLIVASGGISGCAKSSAL-SVAAGLLFCGVSSLGAYQLSQDPMNIWVFLAISGTLNGIIGLRFHYSGWIRPVVLNLSASLL


Parental protein
MVAKLGVSFLSR
.V.K.G.S.L.R
Retrocopy
TVTKFGISVLNR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide