RetrogeneDB ID:
retro_mputfur_1324
Organism:
Location:
GL897082.1:718695-718976 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
77.78 %
Coverage:
70.0 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL23
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L23 [Source:HGNC Symbol;Acc:10316]

Genomic region (view in browser)





>retro_mputfur_1324
AACACAGGAGCCAAAACTCCATTTATCATCTCTGTGAAGGGGATCAAGGGACAACTGAAC
AGACTTCCTGCTGCTGGTGGGGTGACAGGGTGATGGTCACAGTGAAGAAATGTAAACCAG
AGCTCAGAAAGAAGGTACATCCAGCAGTGGTAATTCCACAATGAAAATCATACCAAAGAA
AAGATTATGTGTTTCTCTATTTTGAAGATAACACAGGGATCATAGTAAAGAATATAGGCT
CTGTCATCACAGGACCAGTTGCAAAGGAGTGTGCAGACTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NTGAKNLYIISVKGIKGRLNRLPAAGV-GDMVMATVKKGKPELRKKVHPAVVIRQRKSYRRKDGVFLYFEDNAGVIVNNKGEMKGSAITGPVAKECADL
NTGAK...IISVKGIKG.LNRLPAAG..GD.VM.TVKK.KPELRKKVHPAVVI.Q.KSY.RKD.VFLYFEDN.G.IV.N.G....S.ITGPVAKECADL
Retrocopy
NTGAKTPFIISVKGIKGQLNRLPAAGG/GDRVMVTVKKCKPELRKKVHPAVVIPQ*KSYQRKDYVFLYFEDNTGIIVKNIG----SVITGPVAKECADL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide