RetrogeneDB ID:
retro_mputfur_1328
Organism:
Location:
GL897082.1:3706351-3707026 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
64.19 %
Coverage:
99.55 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
PRDX6
Parental gene aliases:
No gene alias available
Parental gene description:
peroxiredoxin 6 [Source:HGNC Symbol;Acc:16753]

Genomic region (view in browser)





>retro_mputfur_1328
ATGGCTGGATGACTCCTTATTGGGGATAAGTCTCCCAGCTTTGAGGCCAATACTATCTGT
GGCCACATCCATTTCCATGCCTCCCTGAGAGGTCACTCACATAGGGCATTCTTTGTCCTA
TGCTTGAGACTTTACTCCACTGTGAACTACAAAGCTTGGCAGAGCAGCAAATCTGGCATC
AAAATTTACCCAGAGTAATGCTAAAGCTGATAGCTCTTTTAATAGATAGTGTTGAAGATC
ACCTTGCCTGGAGCAAGAGTATCAATGCTTACAATGGTGAGAAGTCCACAGAAATGTTAC
CTTTTCTGGATCACTGATTATAAGAATCAGGAGTTTACTATCCTGTTGGGCATGCTGGAC
CCAGCAGAGAAGAATGAATAGGGCATACCTGTGGCAGCTTGTGTGATGTTTGTTTTTGGT
CCTGATAAGAAATTGAAACTATCATCCTCTATCTAGCTACCTCTGCCAGGAACTTTGATG
AGATTCTCAAAGTAGTTATTTCATTCAAGCTCACATTGGAAAAGAGAGTTGACACCCTGG
TTAACTGGAAAAATGAAGACAGTGTGATGGTCCTTCCAACTATCCCTGAAGAGGCAACCA
AAGAAATTTTCCCTAAACAAGTCTTTACCAAGGTGTTACCATTTAGCAAGGAAAGACCTC
TGCTACACTCCTCAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPGGLLLGDEAPNFEANTTIGRIRFHDYL-GDSWGILF-SHPRDFTPVCTTELGRAAKLAPEFAKKN-VKMIALSVDSVEDHLAWSKDINAYNGQEPTET
M.G.LL.GD..P.FEANT..G.I.FH..L.G.S....F.S...DFTP..TT.LGRAA.LA..F...N..K.IAL..DSVEDHLAWSK.INAYNG...TE.
Retrocopy
MAG*LLIGDKSPSFEANTICGHIHFHASLRGHSHRAFF\SYA*DFTPL*TTKLGRAANLASKFTQSN\LKLIALLIDSVEDHLAWSKSINAYNGEKSTEM


Parental protein
LPFP-IIDDKNRDLAILLGMLDPAEKDEKGMPVTARVVFIFGPDKKLKLS-ILYPATTGRNFDEILRVITSLQLTAEKRVATPVDWKDGDSVMVLPTIPE
LPF..I.D.KN....ILLGMLDPAEK.E.G.PV.A.V.F.FGPDKKLKLS.ILY.AT..RNFDEIL.V..S..LT.EKRV.T.V.WK..DSVMVLPTIPE
Retrocopy
LPFL\ITDYKNQEFTILLGMLDPAEKNE*GIPVAACVMFVFGPDKKLKLS/ILYLATSARNFDEILKVVISFKLTLEKRVDTLVNWKNEDSVMVLPTIPE


Parental protein
DEAKKIFPKGVFTKELPSGK-KYLRYTPQ
...K.IFPK.VFTK.LP..K.K.L.YTPQ
Retrocopy
EATKEIFPKQVFTKVLPFSK\KDLCYTPQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide