RetrogeneDB ID:
retro_mputfur_133
Organism:
Location:
GL897106.1:330719-331718 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.3 %
Coverage:
86.23 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
LDHA
Parental gene aliases:
No gene alias available
Parental gene description:
L-lactate dehydrogenase [Source:UniProtKB/TrEMBL;Acc:C6L2F2]

Genomic region (view in browser)





>retro_mputfur_133
ATGTCAACTATCAAGGAGAAGCTTATTGAGAGTCTAATTGAGGAAGATGAAGCCTCCCAG
AGTAAGATCACCATTGTTGGCACTGGTGCTGTAGGCATGGCTTGTGCTATTTGTATCTTA
TTGAAGGATTTGGCCGATGAACTCACCCTCATTGATGTCTCAGTGGACAAATTGAAGGGA
GAAATGATGGATCTTCAGCATGGCAGTCTTTTCTTTAATACTTCAAAGATTACCTCTGGA
AAAGATTACATAGTATCTGCAAACTCCAAATTAGTTATTGTGACAGCAGGTGCACGGCAA
CAGGAGGGAGAAAGTCGCCTTGCCCTGGTGCAACGGAATGTGAACATCATGAAATCAATC
ATTCCTACCATAGTCCAGCATAGTCCTGACTGTAAGATGCTTATTATTTCAAATCCAGTG
GATATTTTGACATATGTGGTCTGGAAGCTAAGTGGCTTACCTGCAACTCGTATAATTGGA
AGTGGTTGTAATCTAGACTCTGCCCATTTCCGTTACCTAATTGGAGAGAAGTTGGGTGTC
CATCCTGCAAGCTGCCATGGTTGGATTATTGGAGAACATGGTGATTCTAGTGTGCCTTTA
TGGAGTGGGGTGAATGTTGCTGGTGTTGCTCTGAAGACTCTAAATCCTAAATTAGGAACT
GATTCAGACAAAGAGCAGTGGAAAAATATACATAAACAAGTTGTTGAAAGTGCCTATGAG
ATTATCAAACTTAAAGGGTATACCTCTTGGGCTATTGGACTGTCTGTGACAGATCTGGCA
GGATCAATTTTGAAAAATCTTAGGAGAGTGCATCCAGTTTCGACTATGGTTAAGGGCTTA
TATGGAATAAATGAAGAAATCTTTCTCAGTATCCCTTGTATCTTGGGGCGAAATGGTGTC
TCAGATGTTGTGAAAGTTAACTTGAATTCAGAGGAGGAGGCCCTTTTTAAGAAGAGTGCA
GACACAATCTGGAATATCCAAAAAGACCTGGTATTTTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MATLKDQLIQNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYNVTANSKLVIITAGARQ
M.T.K..LI..L..E....Q.KIT.VG.GAVGMACAI.IL.KDLADEL.L.DV..DKLKGEMMDLQHGSLF..T.KI.SGKDY.V.ANSKLVI.TAGARQ
Retrocopy
MSTIKEKLIESLIEEDEASQSKITIVGTGAVGMACAICILLKDLADELTLIDVSVDKLKGEMMDLQHGSLFFNTSKITSGKDYIVSANSKLVIVTAGARQ


Parental protein
QEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLVVSNPVDILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWILGEHGDSSVPV
QEGESRL.LVQRNVNI.K.IIP..V..SP.CK.L..SNPVDILTYV.WK.SG.P..R.IGSGCNLDSA.FRYL.GE.LGVHP.SCHGWI.GEHGDSSVP.
Retrocopy
QEGESRLALVQRNVNIMKSIIPTIVQHSPDCKMLIISNPVDILTYVVWKLSGLPATRIIGSGCNLDSAHFRYLIGEKLGVHPASCHGWIIGEHGDSSVPL


Parental protein
WSGVNIAGVSLKNLHPDLGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIKGLYGIKDDVFLSVPCILGQNGI
WSGVN.AGV.LK.L.P.LGTD.DKEQWK..HKQVV.SAYE.IKLKGYTSWAIGLSV.DLA.SI.KNLRRVHP.STM.KGLYGI....FLS.PCILG.NG.
Retrocopy
WSGVNVAGVALKTLNPKLGTDSDKEQWKNIHKQVVESAYEIIKLKGYTSWAIGLSVTDLAGSILKNLRRVHPVSTMVKGLYGINEEIFLSIPCILGRNGV


Parental protein
SDVVKVTLTTEEEARLKKSADTLWGIQKELQF
SDVVKV.L..EEEA..KKSADT.W.IQK.L.F
Retrocopy
SDVVKVNLNSEEEALFKKSADTIWNIQKDLVF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide