RetrogeneDB ID:
retro_mputfur_1331
Organism:
Location:
GL897084.1:949735-950501 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.42 %
Coverage:
75.58 %
Frameshifts:
5
Stop codons:
4


Parental gene:
Parental gene symbol:
WDR31
Parental gene aliases:
No gene alias available
Parental gene description:
WD repeat domain 31 [Source:HGNC Symbol;Acc:21421]

Genomic region (view in browser)





>retro_mputfur_1331
ATTGCAGAAGAGAGAACTCGAACTAAAGCTTGTCAGCAGTAGAGCCCAGCCCCCATGAAC
ACTGTCTCTGTTGTTGCTCTGAACTCAGACCTGGGTGTCTCCAGAGGAAAAGATAAGCCA
GTCATGGCCTCTAACTTGAAAACTGGAAATGTGGTGAAAGGTTCAGAGAACAGGAACAAG
AAATCACTAAGGTAGCCTGTATTTGCAAATCAAGTCAGTTCTTCAGCACCTGTCGTGAAA
GAATGGTCATGATGTGGGACGTACATGGTCCTTCACAACCAAGGCCACAGTTCCTAGCCA
CACCCTGGTGGTCACTGCATTGGCTATGAGTCCAGACATGTCACAGCTGTGTCCTGGCTC
TTGGGACAGCACCCTGCTTCTGTGGGATGTTGGGACTCGTGTACAGAGAGCCTCCGTCTC
TAGGAACCCAGGCACTTAGCTGCGCTAGGTCCCCCAAGAACAACATACACTTAGACTTCT
GAAGATAAAACCATCAGATTATGGACAGTCGGGGGCTGCAGGTGCCTCATGCATTTCCTA
CAAAGCAGCAATATTCAGACTTCTGCAAGGTCAGCAAGGACAGACACAAATATGTGTCCT
GCAGCAACGGCTTTGGAGGGGAAGGCTGTGAAGCCACATTATGGAACATAAGGCAGACAT
GGAACAGAAAATGAGAATATAAGGGCATTTCCAGACTCTTGCATCCTGCATCTTTCTACC
AAGAGCACTGGCCTCAATGCCTATAATTGCTACTTTATTACATGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
IIEERIQTKACLEYGPAHADSVSVVAALNSDLCVSGGKDKTVVAYNWKSGDVVK-RFRGHEREVTKIACIHGSSLFFSASRDRTARMWDLRGPAQPRQQF
I.EER..TKAC....PA....VSVVA.LNSDL.VS.GKDK.V.A.N.K.G.VVK.RFR..E.E.TK.ACI..SS.FFS..R.R...MWD..GP.QPR.QF
Retrocopy
IAEERTRTKACQQ*SPAPMNTVSVVA-LNSDLGVSRGKDKPVMASNLKTGNVVK/RFREQEQEITKVACICKSSQFFSTCRERMVMMWDVHGPSQPRPQF


Parental protein
-SGHAMVVTGLAVSPDSSQLCTGSRDNTLLLWDVGTGQCMDRASISRNLVTHLCWVPQEPYVLQ-TSEDKTIRLW-DSRGLQVAHVFPAKQHIQTYCEVS
...H..VVT.LA.SPD.SQLC.GS.D.TLLLWDVGT.....RAS.SRN..T.L..VPQE...L..TSEDKTIRLW.DSRGLQV.H.FP.KQ.....C.VS
Retrocopy
/PSHTLVVTALAMSPDMSQLCPGSWDSTLLLWDVGTR--VQRASVSRNPGT*LR*VPQEQHTLR/TSEDKTIRLW/DSRGLQVPHAFPTKQQYSDFCKVS


Parental protein
EDGHKCVSCSNGFGGEGCEATLWDLRQTRNRICEYK-GHFQTVASCVFLPRALASMPIIATSSHD
.D.HK.VSCSNGFGGEGCEATLW..RQT.NR..EYK.GHFQT.ASC.FLPRALASMPIIAT..HD
Retrocopy
KDRHKYVSCSNGFGGEGCEATLWNIRQTWNRK*EYK/GHFQTLASCIFLPRALASMPIIATLLHD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide