RetrogeneDB ID:
retro_mputfur_1332
Organism:
Location:
GL897084.1:1245522-1246227 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
63.07 %
Coverage:
71.52 %
Frameshifts:
5
Stop codons:
2


Parental gene:
Parental gene symbol:
YBX1
Parental gene aliases:
No gene alias available
Parental gene description:
Y box binding protein 1 [Source:HGNC Symbol;Acc:8014]

Genomic region (view in browser)





>retro_mputfur_1332
AAGGAAGATGTATTTGTACACCTGACTGTCATAAAGAGGAGTAATTCCAAGAACTACCTT
CATAGTGTAGGAGGATGGAGGGACTATGGAGTATGATGCTGGTGAAGGGGAAAATGTAAG
GAGGTAGCAAATGGTATAGGTGCTGGTGGAGTTCCAGTACAAGGCAGTAAATATGCAGCA
GATCGTAACCATTATAGGCACTATCCATGGCACATGGGTCCTCCATGCAATTACTAGCAG
AATTGCCAAAATAGTGAGAGTGGGGAAAAGAATGAGGAATTAGACATGCTTTCAAGGCCA
GACCCAACAGTTCCAGACCTTCTGCAGGCAACAACTCCCATCTTACTATATGTGGAGACC
ATGGGGGCATCAACCACAGTCTTCCAAACCGCTTGGGCAGGGTGAAGTGCTGGAAGGTGC
TGACAACCAGAATTCAGGAGCACAAGGTAGACCAGTGAGAGACAGTATGTATCAGGGTCA
CAGACAACAATTCTGCAGGGGCCTCCTTACCAGAGACAACATAGAGAAGACAGCAATAAA
GAAATTAAGGAAAATCAAGGACATAAGACCCACGGTAAGCAGCCACCTCAACACTGGTAC
TTCCACAACTTCAATTACTGACATGAGTGTCAAGGAAACCCCAAACAACAAAGTGGCAAA
GAGATAAAAGCAGCTGATCCACCAGCAAAGAATTCATCTGCCCCA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KEDVFVHQTAIKKNNPRKYLRSVG-DGETVEFDVVEGE-KGAEAANVTGPGGVPVQGSKYAADRNHYRRYPRHRGPPHNYQQNYQNSESGEKNE-GSESA
KEDVFVH.T.IK..N...YL.SVG.DG.T.E.D..EGE.K..E.AN..G.GGVPVQGSKYAADRNHYR.YP.H.GPP.NY.QN.QNSESGEKNE.G...A
Retrocopy
KEDVFVHLTVIKRSNSKNYLHSVG\DGGTMEYDAGEGE/KCKEVANGIGAGGVPVQGSKYAADRNHYRHYPWHMGPPCNY*QNCQNSESGEKNE/GIRHA


Parental protein
PEGQAQQRRP-YRRRRFPPYYMRRPYGRRPQYSNPPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRR-GPPRQRQPREDGNEEDKENQGDETQGQQ
........RP...R...P.YYM.RP.G..PQ.S.P..QGEV.EGADNQ..G.QGRPVR..MY.G.R..F.R.GPP.QRQ.RED.N.E.KENQG..T.G.Q
Retrocopy
FKARPNSSRP/FCRQQLPSYYMWRPWGHQPQSSKPLGQGEVLEGADNQNSGAQGRPVRDSMYQGHRQQFCR/GPPYQRQHREDSNKEIKENQGHKTHGKQ


Parental protein
PPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAP
PPQ..Y..NFNY......NPK.Q.GKE.KAADPPA.NSSAP
Retrocopy
PPQHWYFHNFNY*HECQGNPKQQSGKEIKAADPPAKNSSAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide