RetrogeneDB ID:
retro_mputfur_1338
Organism:
Location:
GL897087.1:768730-769045 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
57.8 %
Coverage:
90.68 %
Frameshifts:
2
Stop codons:
4


Parental gene:
Parental gene symbol:
ATP6V1G1
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G1 [Source:HGNC Symbol;Acc:864]

Genomic region (view in browser)





>retro_mputfur_1338
ATGGCCAGTCAGTCACAGGGTTTACAGCAGCTTCTGTAGACTAAGAAGTGGGTACCCAGA
AAGTGTCCAAGGTCCACATGCAAAAAGAAATGGAAGCTGAAGCAGGCCATAGCAGCTCAA
GCAGAAATAGAATAGTACAATCTACAAAGTGAAAAAAGTGTCCAAGCTTGATGAAACTGC
AGCCCTGAGATCCCATGGCAGGGGCAGTACTGAAATGGAGGAGACTCGAGAGATAATGAC
CATCCTTCAGACCTAATTCCAGTAAACAGGGATTAAGTCCTAGATAACCTCTTGGACTTT
GAGACATCAACCAGA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MASQSQGIQQLLQAEKRAAEKVSEARKRKNRRLKQAKEEAQAEIEQYRLQREKEFKA-KEAAALGSHGSCSTEVEKETQEKMTILQTYFQ-QNRDEVLDN
MASQSQG.QQLL...K....K.......K...LKQA...AQAEIE.Y.LQ.EK...A..E.AAL.SHG..STE.E.ET.E.MTILQT.FQ..NRD.VLDN
Retrocopy
MASQSQGLQQLL*TKKWVPRKCPRSTCKKKWKLKQA-IAAQAEIE*YNLQSEKSVQA\DETAALRSHGRGSTEME-ETREIMTILQT*FQ/VNRD*VLDN


Parental protein
LLAFVCDIR
LL.F....R
Retrocopy
LLDFETSTR


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide