RetrogeneDB ID:
retro_mputfur_1341
Organism:
Location:
GL897088.1:3528184-3528509 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
71.56 %
Coverage:
72.3 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
TMEM216
Parental gene aliases:
No gene alias available
Parental gene description:
transmembrane protein 216 [Source:HGNC Symbol;Acc:25018]

Genomic region (view in browser)





>retro_mputfur_1341
CAGTTTCCATGGGCACTAAAGATGGTTTCCAGAAGGACATGGCTGGCATTCACCTCCACC
ACTGGAAATCCTGTTCTTTCTGAACAGGTGGTACTATGTTACCTGAATCCTGCTGGAACT
CTTCATATTTCTGTCGAAAGCTCTCCTGTTACCATATCCAACAGCGAATCTAGTCCTAGA
CATGATGATGTTTCTCCTTTGCCTTGGAGTTGAAGGAGTTCAACTATTTTTTGGTACAAA
GGGAAACCTCTGCCAATAAAAGATGCCCCTTGGCGTTAGCATGGCCTTGACCTTCCCACC
TGTCACAGTGGCCTCCGATTATCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
QFPWGLKMA-PRGKRLSSTP-LEILFFLNGWYYATYFLLELFIFLYKALLLPYPTANLVLDVVMLLLYLGIEVIRLFFGTKGNLCQRKMPLGISVALTFP
QFPW.LKM..P.G....S.P.LEILFFLN.WYY.T..LLELFIFL.KALLLPYPTANLVLD..M.LL.LG.E...LFFGTKGNLCQ.KMPLG.S.ALTFP
Retrocopy
QFPWALKMV\PEGHGWHSPPPLEILFFLNRWYYVT*ILLELFIFLSKALLLPYPTANLVLDMMMFLLCLGVEGVQLFFGTKGNLCQ*KMPLGVSMALTFP


Parental protein
SAMMASYYL
....AS.YL
Retrocopy
PVTVASDYL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide