RetrogeneDB ID:
retro_mputfur_1343
Organism:
Location:
GL897089.1:1468652-1469032 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.38 %
Coverage:
99.22 %
Frameshifts:
3
Stop codons:
4


Parental gene:
Parental gene symbol:
H2AFZ
Parental gene aliases:
No gene alias available
Parental gene description:
H2A histone family, member Z [Source:HGNC Symbol;Acc:4741]

Genomic region (view in browser)





>retro_mputfur_1343
GCTGGCGGTGAGGCTGGGAAGACTCTGGAAAGGCCACGACAAAGGCGGTTTCCCACTCAC
AGAGAGCCAGCTTGCAGTTCCCGGTGGTCCACGTTCAATGACACCTGAAACTAGGACAAC
CAGTTATGGATGTGTGGGCGCGGCTGTTGCTATGTACAGTGCAGCCATCCTGGAGTAGAG
GAACCACAGAGGTACTTGAATTGGCAGGAAATGCATCAAAAGACTTAAAGGTAAAGCATA
TTACTCCTCCTCACTTGTAGCTTACTATTGGTGGAGATCGAGAGTTGGGCTCTTTCATCA
AGGCTGCAGTTGCTGGTGGTGGTGTCATTCCACACATCCACAAATCTCTGATTGGGAAGA
AAGGACAAAGGAAGACTGTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AGGKAGK-DSGKAKTKAVSRSQRAGLQFPVGRIHRHLK-SRTTSHGRVGATAAVYSAAILEYLTAEVLELAGNASKDLKVK-RITPRHLQLAIRGDEELD
AGG.AGK.DSGKA.TKAVS.SQRA.LQFPV.....HLK..RTTS.G.VGA..A.YSAAILE..............K.LK.K..ITP.HL.L.I.GD.EL.
Retrocopy
AGGEAGK/DSGKATTKAVSHSQRASLQFPVVHVQ*HLK/TRTTSYGCVGAAVAMYSAAILE*RNHRGT*IGRKCIKRLKGK\HITPPHL*LTIGGDRELG


Parental protein
SLIKATIAGGGVIPHIHKSLIGKKGQQKTV
S.IKA..AGGGVIPHIHKSLIGKKGQ.KTV
Retrocopy
SFIKAAVAGGGVIPHIHKSLIGKKGQRKTV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide