RetrogeneDB ID:
retro_mputfur_1346
Organism:
Location:
GL897090.1:820072-820597 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
76.67 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ARPC3
Parental gene aliases:
No gene alias available
Parental gene description:
actin related protein 2/3 complex, subunit 3, 21kDa [Source:HGNC Symbol;Acc:706]

Genomic region (view in browser)





>retro_mputfur_1346
ATCCCAGCTTACCACTCTTCTCTCATGGACCTTGACACCAAAATCATTAGAAACATGGCA
CTGTTGCCTATCAGAAGTCAGTTCAAAGGACCCATCCCTAGAGAGACAAAAGATATAGGC
ATTGTGGATGAAGCCATCTTATTACTTCAAGGCCAATGTCTTATTAAAAAACTATAAGAT
TAAGAATGAAGCTAATGGAACCTTGATATATATAATTCTCTAGTGTCTAAAGAATCTCCA
AAAGTGCAATTCCAAAAACCAAGGTGAAAAAGAAATGTATGCACTAGGAATCAGTAATTT
TCCCATTCCTGGAGAGCCTGGTTTTAAACTTCATGCAATCTATCCCACCCCAGCAAACAA
ACAGGAAGGTAAGGTGATAAGGGTCTACTTACAGCAGTTGAGACAAGAAACTGGACAGAG
ATTTGTGACAACATTTTTGACCCTCAGAATGATAAACATAGCAAGTGGTGGACTTATTTT
ATAAAGAGACAGCTCATGAAAAAGAGACTTTCAGGACCTGGACAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPAYHSSLMDPDTKLIGNMALLPIRSQFKGPAPRETKDTDIVDEAI-YYFKANVFFKNYEIKNEADRTLIYITLYISECLKKLQKCNSKSQGEKEMYTLG
.PAYHSSLMD.DTK.I.NMALLPIRSQFKGP.PRETKD..IVDEAI.YYFKANV..KNY.IKNEA..TLIYI...I..CLK.LQKCNSK.QGEKEMY.LG
Retrocopy
IPAYHSSLMDLDTKIIRNMALLPIRSQFKGPIPRETKDIGIVDEAI\YYFKANVLLKNYKIKNEANGTLIYI---IL*CLKNLQKCNSKNQGEKEMYALG


Parental protein
ITNFPIPGEPGFPLNAIYAKPANKQEDEVMRAYLQQLRQETGLR-LCEKVFDPQNDKPSKWWTCFVKRQFMNKSLSGPGQ
I.NFPIPGEPGF.L.AIY..PANKQE..V.R.YLQQLRQETG.R..C...FDPQNDK.SKWWT.F.KRQ.M.K.LSGPGQ
Retrocopy
ISNFPIPGEPGFKLHAIYPTPANKQEGKVIRVYLQQLRQETGQR/ICDNIFDPQNDKHSKWWTYFIKRQLMKKRLSGPGQ


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide