RetrogeneDB ID:
retro_mputfur_1347
Organism:
Location:
GL897091.1:688206-688622 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
66.9 %
Coverage:
80.0 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS10
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S10 [Source:HGNC Symbol;Acc:10383]

Genomic region (view in browser)





>retro_mputfur_1347
GCAGCCACCAAGACGTTGATGCCCAAAAAGAACCAAATTGCCATTTATAAACTCCTTTTC
AAGGAGGGAGTGATGGTGGCCAAGAAGGATGTCCCCATGCCCAAATGCCCTGAGCGGGCA
GACAAGACTGTGCCCAACTTCACGTCATGAAGACCACACAATCTTCAAATCATGAGTCTA
CAGAAAGCAAAGAAAGTTTGCCTGGAGACATTTCTACTGGTAACTTACCAAAAATGATAG
CCAGTATCTCCTGTGATTACCTCCATCTGCCCCCCGGGACTGTGCCTGCCGCTCTGCGCC
GCAGCCGCCCCAAGACTGGCAGACCATGGCCCAAAGGTCTGGAGGTAGAGCAGCAGCCTG
CAAGACTCACACAAGGGGAAGCTGACAGACCCCTAGATACAAAGCGCTGTGCCCCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
ASFQMLMPKKNRIAIYELLFKEGVMVAKKDVHMPKHPELADKNVPN-LHVMKAMQS-LKSRGYVKE-QFAWRHFYWYLTNEGIQYLR-DYLHLPPEIVPA
A....LMPKKN.IAIY.LLFKEGVMVAKKDV.MPK.PE.ADK.VPN.LHVMK..QS..KS..Y.K...FAWRHFYW.LT....QYL..DYLHLPP..VPA
Retrocopy
AATKTLMPKKNQIAIYKLLFKEGVMVAKKDVPMPKCPERADKTVPN/LHVMKTTQS/FKS*VYRKQRKFAWRHFYW*LTKNDSQYLL\DYLHLPPGTVPA


Parental protein
TLRRSRPETGRPRPKVCIGLEGE-RPARLTRGEADRDTYRRSAVP
.LRRSRP.TGRP.PK...GLE.E..PARLT.GEADR........P
Retrocopy
ALRRSRPKTGRPWPK---GLEVEQQPARLTQGEADRPLDTKRCAP


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide