RetrogeneDB ID:
retro_mputfur_1353
Organism:
Location:
GL897093.1:3349196-3349445 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.0 %
Coverage:
72.41 %
Frameshifts:
0
Stop codons:
2


Parental gene:
Parental gene symbol:
NDUFA5
Parental gene aliases:
No gene alias available
Parental gene description:
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5 [Source:HGNC Symbol;Acc:7688]

Genomic region (view in browser)





>retro_mputfur_1353
GATGTTCTTAAGCAAATTCCTAAAAATGCAGCATATAGAAAGTATACAGAACAGGTTACA
AATGAGTAGCTAAGTATAGTTAAAGCAGAACCAGGTATTAAGAAATTAGAAGACCGAGTT
CGGGGAGGCTACCTAGAAGAGGTGATTCTTCAGGCTGAAATGAACTAGGTCGGCAAGAAA
ATGATACAGTGGAAACCATGGGAGCCCTTAGTGGAAAAGCCTCCTGCCAACCAATGGAAA
TGGACAATA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
DVLEQIPKNAAYRKYTEQITNEKLSMVKAEPDVKKLEDQLQCGQLEEVILQAENELSLARKMLQWKPWEPLVEEPPANQWKWPI
DVL.QIPKNAAYRKYTEQ.TNE.LS.VKAEP..KKLED....G.LEEVILQAE.......KM.QWKPWEPLVE.PPANQWKW.I
Retrocopy
DVLKQIPKNAAYRKYTEQVTNE*LSIVKAEPGIKKLEDRVRGGYLEEVILQAEMN-*VGKKMIQWKPWEPLVEKPPANQWKWTI


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide