RetrogeneDB ID:
retro_mputfur_1356
Organism:
Location:
GL897094.1:3035858-3036144 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
79.59 %
Coverage:
61.01 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
EFCAB10
Parental gene aliases:
No gene alias available
Parental gene description:
EF-hand calcium binding domain 10 [Source:HGNC Symbol;Acc:34531]

Genomic region (view in browser)





>retro_mputfur_1356
CCAGAAAAACCAAGACGGTATTTAATATTGGAATGACTGAGAATTACCAAAATAACAGGC
ATGGCTTTTTCCTCTCTTTATGGATCACTCTAACATTTTATCTATGTTTGAGATGATGGA
CACTTCAAATAAAGGCACCGTATCATTTGTGTAGTACAAGGAGGCCCTAAAAACCCCAGG
TCTGTTGAATGAAGATGAAGTTTTACAAGATGATGGACATGTAATAACTTTGGAAAAATC
CAGATCTGAAGTGAATAAGAGCATTGAGAAAATATGGTCAGCATTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PEKPREYLISILERLRIAKVTGVAF-PFFMDHSNIVSMFEMMDTSHKGTISFVQYREGLKTLGLLDEDEVLQDDGHVITLEKFRSEVNKRTEKIWSAF
PEKPR.YLI..LE.LRI.K.TG.AF.P.FMDHSNI.SMFEMMDTS.KGT.SFV.Y.E.LKT.GLL.EDEVLQDDGHVITLEK.RSEVNK..EKIWSAF
Retrocopy
PEKPRRYLI--LE*LRITKITGMAF\PLFMDHSNILSMFEMMDTSNKGTVSFV*YKEALKTPGLLNEDEVLQDDGHVITLEKSRSEVNKSIEKIWSAF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide