RetrogeneDB ID:
retro_mputfur_1360
Organism:
Location:
GL897096.1:2380361-2380843 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.87 %
Coverage:
93.68 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
PRDX5
Parental gene aliases:
No gene alias available
Parental gene description:
peroxiredoxin 5 [Source:HGNC Symbol;Acc:9355]

Genomic region (view in browser)





>retro_mputfur_1360
TCTGTAGCATGGGTGGTGACAAGAGCAGGAGGGTGCCAGCAATAAAACAGGGAATAGATG
CTTGGTGAGGCCTCAGTTTCAGCAGCGCTTTCTCAGACATGGCCCCAATCAAGTTGGGGA
TGCCATCGCTTCACTGGTGGCTATTGAAGGGGAGCCTGGGAACAAGGTGAACCTGGCAGA
GCTGTTCAAAGGCACAGAGTGCTGTTTGGAAAGCCCAGGGTCTTTAGTCCAGGCTGTTCC
AAGACCCACTTGTCAGGGTTTGTGGAGCAGGCTGAGGCTCTGAGGGCCAAGGGGGTTCAG
GTGGTAGTATGTCTGAGTATTGATGATGCTTTTGTGACTAAACTGTGGGAACCAGTTCAC
AATTCAGGAGGCAAGGTTATCCTCTTGGCTGACTCTACTGGGACCTTTGGGAAGGAAACT
GATTTGTTACTAGATGATTCATTGGTGGTGTCTTTGGAAATTGCCAGCTCAAAAGGTTCT
CC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SAAAAASRAGGCRQPGREWTLGGAC-GFRSAASAMAPIK-VGDTIPSVVVFEGEPKNQVNLAELFKGKKGVLFGVPGA-FTPGCSKTHLPGFVEQAEALK
S.A....RAGGC.Q..RE..LG.A...F.SA.S.MAPIK.VGD.I.S.V..EGEP.N.VNLAELFKG....L...PG..F.PGCSKTHL.GFVEQAEAL.
Retrocopy
SVAWVVTRAGGCQQ*NRE*MLGEAS/SFSSAFSDMAPIK/VGDAIASLVAIEGEPGNKVNLAELFKGTECCLES-PGS/FSPGCSKTHLSGFVEQAEALR


Parental protein
ARGVQVVACLSVNDVFVTEEWGRAHNARGKVRLLADPTGAFGKETDLLLDDSLV-SLFGNHRLKRFS
A.GVQVV.CLS..D.FVT..W...HN..GKV.LLAD.TG.FGKETDLLLDDSLV...FGN..LKRFS
Retrocopy
AKGVQVVVCLSIDDAFVTKLWEPVHNSGGKVILLADSTGTFGKETDLLLDDSLV/GVFGNCQLKRFS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide