RetrogeneDB ID:
retro_mputfur_1361
Organism:
Location:
GL897096.1:2526578-2527129 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.83 %
Coverage:
100.0 %
Frameshifts:
4
Stop codons:
6


Parental gene:
Parental gene symbol:
PEBP1
Parental gene aliases:
No gene alias available
Parental gene description:
phosphatidylethanolamine binding protein 1 [Source:HGNC Symbol;Acc:8630]

Genomic region (view in browser)





>retro_mputfur_1361
ATGTCAGTAGACCTCAGCAAATGGTTCTAGCCCTTGAGCCTGCAGGAAGTGGATGAGCAG
CGGCAGCATCTGTTGCAGCTCAGATACACCAGGGCGGAGGTGGACGAGCTGGGCACATTG
CTGACCCAGCCTAGGTTAAGAACTGTCCCACCAGTGTTGCATGGCATATCCTTGAACTGG
GTGGACTCCACACTTGGTCATGACATATCCAGAAGCACCCAGCAGAAAGGACCCCAAATG
CAGGGAATGGCACCCTTTTGGGGGGTCAACATGCAAGACAATGACAGCAGCAGTGCACAG
TCTTCTACCATTTTGGTGGCTCTGGGCCTCCCATGGGGATAGGCCTTCACTGCTACATCT
GGCTGGTTTAAGAGCAGAATCGATCACTGAAGTGACCTATTCCCAGCAACCAATCTGGAG
ACCACTGTAGCAAATTCAAAGAGGCACCTTTCCACATAAATCACGACCTCGGGCCACCGG
TGGCCAGCACATGTTGACAGGCTGAATGAGATGACTGTGTCCCCAAACACTGTGAGCAGC
TGTCTAGGAAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPVDLSKWSGPLSLQEVDERPQHPLQVKYTGTEIDELGKVLT-PTQVKNRPTSIAWDGLDSGKLYT-LVMTDPDAPSRKDPKYREWHHF-LVVNMKGNDI
M.VDLSKW..PLSLQEVDE..QH.LQ..YT..E.DELG..LT.P..VKN.PTS.AW..L..G.L.T.LVMT.P.APSRKDPK.REWH.F...VNM..ND.
Retrocopy
MSVDLSKWF*PLSLQEVDEQRQHLLQLRYTRAEVDELGTLLT/PA*VKNCPTSVAWHILELGGLHT/LVMTYPEAPSRKDPKCREWHPF/WGVNMQDNDS


Parental protein
SSG-TVLSDYVGSGPPKGTGLHRYVWLVYEQKGPLKCDEPILSNRSGDHRGKFKVASFRKKYELGPPVAGTCYQAEWDDYVPKLYEQLSGK
SS..TV.....GSGPP.G.GLH.Y.WLV.EQ...LK...PI.SN.SGDH..KFK.A.F.....LGPPVA.TC.QAE.DD.VPK..EQLS.K
Retrocopy
SSA/TVFYHFGGSGPPMGIGLHCYIWLV*EQNRSLK*--PIPSNQSGDHCSKFKEAPFHINHDLGPPVASTC*QAE*DDCVPKHCEQLSRK


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide