RetrogeneDB ID:
retro_mputfur_1364
Organism:
Location:
GL897097.1:2920161-2920502 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.08 %
Coverage:
96.69 %
Frameshifts:
1
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1364
CGTTATAGCCAATAGAGGAGAAGCAGGTCACAGTCTAGATAACATTTAAGATCCAGAGGT
AGGTGATACTCTTGCTCATGTAGCAGGAGCAGGGAAAGGAGTCAAGATCAGCATTTCCTC
AGCCATCAAGATCTGTGTCTCTTTCAACATCAACCTTCACACAGAAGATCTAGATCTGGT
TCTATAAAAGGATCAAGATCCCTGTCGAGGCCAAGGTCAAGGTCAAGATCCAGGTCTGTT
TCACTACATGCAAGAAGCAGCCAAAGTCCAGATCTCCACCTCCAAAGAGAATTCATTCCC
CATCAGGAAGTCCGCAAAGAAGTGCACGTCCTGAAAGAGTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RGSTCKLARSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIKGSRYFQSRSRSRSRSRSLSRPRSS-RSKSRSPSPK
R.S.....RS.SR.H.RSRGR.Y..S.S.SR.R.........S...........S.RRSRSGSIKGSR...SR.RSRSRSRS.S....S...KSRSP.PK
Retrocopy
RYSQ*RRSRSQSR*HLRSRGR*Y--SCSCSRSRERSQDQHFLSHQDLCLFQHQPSHRRSRSGSIKGSRSL-SRPRSRSRSRSVSLHARS/QPKSRSPPPK


Parental protein
RSRSPSGSPRRSASPERV
R..SPSGSP.RSA.PERV
Retrocopy
RIHSPSGSPQRSARPERV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide