RetrogeneDB ID:
retro_mputfur_1365
Organism:
Location:
GL897097.1:3147001-3147347 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
55.37 %
Coverage:
99.15 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
Ddt
Parental gene aliases:
No gene alias available
Parental gene description:
D-dopachrome tautomerase [Source:MGI Symbol;Acc:MGI:1298381]

Genomic region (view in browser)





>retro_mputfur_1365
CCGTCTGTGGAGCTGGACGCGCACTTGGCTGCAGCCCGCGTGCCTGCGGGATTGGAGAAG
CGGCTGGGCATGGCCAGTGCAGCCATCCTGGGCAAACCTGAGGACCGCGTGAACACGACG
GTGCCACCGGGTCTGGCCCTGGCTACGTCACTCCACTGTGCCCAGCGCGCAGCTGCTCAT
CTCCTCTGTCCGTGTGTGGGCACCGGGGAAGAGAACTGCGGCTCCAGGGTTCGACTCCTC
CGGTTCCTCCCAAGGAGCTGGACCTGGGCCAGGATCGGATCATTACGCGCATTCTCCCAG
TGGAGTCATAGTAGCTAGGCAAAAAGGGACAGTAATGCCTTTTCTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
PFVELDTNLSAGRVPTGLEKRLCAATADILSKPEDRVNVTVRPGLAMA--VNGSTEPCAQLLISSIGVVGTAEDNRGHSARFFEFL-TKELNLDQDRIII
P.VELD..L.A.RVP.GLEKRL..A.A.IL.KPEDRVN.TV.PGLA.A..........A.LL....G...T.E.N.G...R...FL..KEL.L.QDRII.
Retrocopy
PSVELDAHLAAARVPAGLEKRLGMASAAILGKPEDRVNTTVPPGLALATSLHCAQRAAAHLLCPCVG---TGEENCGSRVRLLRFL/PKELDLGQDRIIT


Parental protein
RFFPVEPWQIGK-KGTVMTFL
R..PVE....GK.KGTVM.FL
Retrocopy
RILPVES**LGK/KGTVMPFL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide