RetrogeneDB ID:
retro_mputfur_1367
Organism:
Location:
GL897098.1:402492-402936 (-)
Status:
KNOWN_PSEUDOGENE
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.19 %
Coverage:
51.74 %
Frameshifts:
2
Stop codons:
2


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1367
ATAGCGTGTGAAAGAGCTGAGAAGGCAGATATTAAGGAGAAGAAACCTGAAGCCAAGATG
GCTGATGCTGGTGGCAGGATGAAGAAGGATAAACTCAAAGCTAAAACACCAATGGAAGGG
AAGCCCCACCACAGTCCAAACCCTGGGCTAGCCAAGGAATTGGCAGATATTTCCCAAGGG
CTATGTATTCCAGAAAGGCTATGTACAACAGGAAGTATTCAGCAGCTAAATCCAGAGTTG
AAAAGAAAAAGAAGAAGGTTCCTGCTACTGTCACAAAACCAGCTGGTGGTGACAAGAACC
GTGGTACCTGAGAGGTTAAACTTCCCCACATGCCTAGGTATTATCCTACTGAAGATGTGG
TTTGAAAGATTTTGAGCCATGGCAAAAAAACATTTCAGGCAACATGTGAGAAAACTTCAA
GCTAGCATCACTGGTGGCACCCTT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAGEKAEKPDTKEKKPEAKKTDGGGKAKKGNKKAKTPKKGKPHCSRNPVLVR-GIGRYSRSAMYSRKAMYKRKYSAAKSRVEKKKKEKVLATVTKPVGGD
.A.E.AEK.D.KEKKPEAK..D.GG..KK...KAKTP..GKPH.S.NP.L...GIGRY...AMYSRKAMY.RKYSAAKSRVEKKKK.KV.ATVTKP.GGD
Retrocopy
IACERAEKADIKEKKPEAKMADAGGRMKKDKLKAKTPMEGKPHHSPNPGLAK/GIGRYFPRAMYSRKAMYNRKYSAAKSRVEKKKK-KVPATVTKPAGGD


Parental protein
KNGGTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFS-QHVRKLRASITPGTI
KN.GT..VKL..MPRYYPTEDV..K.LSHGKK.F..QHVRKL.ASIT.GT.
Retrocopy
KNRGT*EVKLPHMPRYYPTEDVV*KILSHGKKTFQ\QHVRKLQASITGGTL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide