RetrogeneDB ID:
retro_mputfur_1375
Organism:
Location:
GL897102.1:2874623-2876612 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
87.11 %
Coverage:
90.26 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
PAPOLA
Parental gene aliases:
No gene alias available
Parental gene description:
poly(A) polymerase alpha [Source:HGNC Symbol;Acc:14981]

Genomic region (view in browser)





>retro_mputfur_1375
ATGCCGTTTCCGGTGACAACCTCCGGATCACAACAGACACCGCCGCCGCCCAAGCGCTAT
GGCATCTCCTCCCCCATCAGCTTAGCAGCCCCCAAGGAGACTGACTGCGTACTTACCCAG
AAGTTAATTGAAACCCTGAAGCCCTTTGGGGTTTTTGAAGAGGAAGAGGAACTGCAGCGC
AGGATTTTAATTTTGGAAAAATTAAATAATCTGGTAAAGGAATGGATAAGAGAAATCAGT
GAAAGCAAGAGCCTTCCACAAGCTGTAATTGAAAATGTTGGAGGGAAAATCTTTACGTTT
GGCTCTTACAGATTAGGAGTACACACGAAAGGCGCTGACATTGATGCGCTGTGCGTTGCG
CCGAGACATGTTGATCGAAGTGACTTTTTCACCTCATTCTATGACAAATTGAAACTACAC
GAAGAAGTAAAAGATTTAAGGGCTGTTGAGGAGGCCTTTGTACCAGTTATTAAACTGTGT
TTTGATGGTATAGAGATTGATATTTTGTTTGCGAGGTTGGCACTGCAGACTATTCCAGAA
GATTTGGACCTAAGAGATGACAGTCTGCTTAAAAACTTAGATATTAGATGCATAAGAAGC
CTTAACGGTTGCCGGGTGACAGATGAAATTTTACATCTAGTTCCAAACATTGACAACTTC
AGGTTAACTCTCAGAGCCATCAAACTGTGGGCCAAATGCCACAATATCTATTCCAATATA
TTAGGATTCCTGGGAGGTGTTTCTTGGGCCATGCTAGTAGCGAGAACTTGCCAGCTCTAC
CCAAATGCAATAGCATCAACTCTTGTTCGTAAGTTTTTCTTGGTATTTTCAGAATGGGAA
TGGCCAAATCCAGTGCTACTGAAAGAGCCTGAAGAGCGGAATCTTAATTTGCCTGTATGG
GACCCAAGAGTAAATCCCAGTGATAGGTACCATCTTATGCCCATAATCACACCAGCGTAC
CCACAGCAGAACTCCACATACAATGTGTCTGTTTCAACAAGGATGGTCATGATTGAGGAG
TTTAAACAAGGGCTTGCTATCACACATGAAATTTTGCTGAGTAAGGCAGAGTGGTCTAAG
CTTTTTGAAGCTCGAAGCTTCTTTCAAAAGTATAAGCATTATATTGTACTCCTAGCAAGT
GCACCAACAGAAAAACAACATCTAGAATGGGTGGGCTTGGTGGAGTCAAAAATCCGAATC
CTGGTTGGAAGCTTGGAGAAGAATGAATTTATTACTCTGGCGCATGTGAATCCTCAGTCG
TTTCCGGCACCTAAAGAAAATCCTGACAAGGAACAATTTCGTACAATGTGGGTGATTGGG
TTAGTGTTAAAAAGGCCAGAAAACTCCGAGGTTCTCAGTATTGATCTCACCTATGATATC
CAGTCTTTCACAGATACCGTTTATAGGCAAGCAATAAATAGCAAGATGTTTGAGATGGAT
ATGAAAATTGCTGCAATGCATTTAAGAAGAAAGGAACTTCATCAACTGCTGCCTAATCAT
GTGCTTCAGAAACGGAAAACCCATTCATCGGAAGGTGTCACTTTAACAGCTTTGAGTGAC
AGCAGCCTTGGCTTGTCTACAGACAGTGAAGACAGCATGTCTGTGCCTTTACCTGCTGGC
ACTATGAAGACCGGCCCAGTGACTGGCAGCTCTCAGGGCAGAAACAGTCCTGCTCCTGCT
GTAATGGCAGCATCTGTGACCGCCGTACAAGTTACTGAAGTTTCCTTGCAACAAGGGACT
CCAAGCGAAAGCTTAGGAGGTGCGTCAAGCGAAAGCATTCCTCAGACTGCCTCACAGCCA
GCCCTCCTTCCACTACCAAAGGCCACAGTTGCCAGAGTTGTTTCTTCAACACGTCTGGTA
AACCATCCACCCAGGCCTTCAGGGAGCACTGCGACAAACATAGCTAATCCTATCGTGGGC
GTCTAGTCGGCATTCTCACCTCATAAAGGACCAAGGAAACTAAAAGAAGAGGAACAGACT
CATAAAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MPFPVTTQGSQQTQPPQKHYGITSPISLAAPKETDCLLTQKLIETLKPFGVFEEEEELQRRILILGKLNNLVKEWIREISESKNLPQSVIENVGGKIFTF
MPFPVTT.GSQQT.PP.K.YGI.SPISLAAPKETDC.LTQKLIETLKPFGVFEEEEELQRRILIL.KLNNLVKEWIREISESK.LPQ.VIENVGGKIFTF
Retrocopy
MPFPVTTSGSQQTPPPPKRYGISSPISLAAPKETDCVLTQKLIETLKPFGVFEEEEELQRRILILEKLNNLVKEWIREISESKSLPQAVIENVGGKIFTF


Parental protein
GSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLQEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRS
GSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKL.EEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRS
Retrocopy
GSYRLGVHTKGADIDALCVAPRHVDRSDFFTSFYDKLKLHEEVKDLRAVEEAFVPVIKLCFDGIEIDILFARLALQTIPEDLDLRDDSLLKNLDIRCIRS


Parental protein
LNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKRHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVHKFFLVFSKWEWPNPVLLKQPEECNLNLPVW
LNGCRVTDEILHLVPNIDNFRLTLRAIKLWAK.HNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLV.KFFLVFS.WEWPNPVLLK.PEE.NLNLPVW
Retrocopy
LNGCRVTDEILHLVPNIDNFRLTLRAIKLWAKCHNIYSNILGFLGGVSWAMLVARTCQLYPNAIASTLVRKFFLVFSEWEWPNPVLLKEPEERNLNLPVW


Parental protein
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMVEEFKQGLAITDEILLSKAEWSKLFEAPNFFQKYKHYIVLLASAPTEKQRLEWVGLVESKIRI
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVM.EEFKQGLAIT.EILLSKAEWSKLFEA..FFQKYKHYIVLLASAPTEKQ.LEWVGLVESKIRI
Retrocopy
DPRVNPSDRYHLMPIITPAYPQQNSTYNVSVSTRMVMIEEFKQGLAITHEILLSKAEWSKLFEARSFFQKYKHYIVLLASAPTEKQHLEWVGLVESKIRI


Parental protein
LVGSLEKNEFITLAHVNPQSFPAPKENPDKEEFRTMWVIGLVFKKTENSENLSVDLTYDIQSFTDTVYRQAINSKMFEVDMKIAAMHVKRKQLHQLLPSH
LVGSLEKNEFITLAHVNPQSFPAPKENPDKE.FRTMWVIGLV.K..ENSE.LS.DLTYDIQSFTDTVYRQAINSKMFE.DMKIAAMH..RK.LHQLLP.H
Retrocopy
LVGSLEKNEFITLAHVNPQSFPAPKENPDKEQFRTMWVIGLVLKRPENSEVLSIDLTYDIQSFTDTVYRQAINSKMFEMDMKIAAMHLRRKELHQLLPNH


Parental protein
VLQKKKKHSTEGVRLTPLNDSSLDLSMDSDNSMSVPSPTSAMKTSPLNSSGSSQGRNSPAPAVTAASVTNIQATEVSVPQVNSSESSGGTSSESIPQTAT
VLQK.K.HS.EGV.LT.L.DSSL.LS.DS..SMSVP.P...MKT.P....GSSQGRNSPAPAV.AASVT..Q.TEVS..Q...SES.GG.SSESIPQTA.
Retrocopy
VLQKRKTHSSEGVTLTALSDSSLGLSTDSEDSMSVPLPAGTMKTGPV--TGSSQGRNSPAPAVMAASVTAVQVTEVSLQQGTPSESLGGASSESIPQTAS


Parental protein
QPAISPPPKPTVSRVVSSTRLVNPPPRPSGNAATKIPNPIVGVKRTSSPHKEESPKKTKTEEDETSE
QPA..P.PK.TV.RVVSSTRLVN.PPRPSG..AT.I.NPIVGV....SPHK...P.K.K.EE....E
Retrocopy
QPALLPLPKATVARVVSSTRLVNHPPRPSGSTATNIANPIVGV*SAFSPHK--GPRKLKEEEQTHKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide