RetrogeneDB ID:
retro_mputfur_1381
Organism:
Location:
GL897105.1:1273896-1274325 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
59.06 %
Coverage:
60.32 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
ATP6V1D
Parental gene aliases:
No gene alias available
Parental gene description:
ATPase, H+ transporting, lysosomal 34kDa, V1 subunit D [Source:HGNC Symbol;Acc:13527]

Genomic region (view in browser)





>retro_mputfur_1381
GAGGATAATGCCACAGGTGATAACTTTGTATTTGAACATCACCATGAAGGAACTGACAGT
TACAAACTGACTGGTTTAGCCAGAAGTGGGGACCATGCGTCTGAATTAAAGAGGAATAAT
GCCCAAGCAGTAGGAGCAGCTTCGAAGCGGACTTCCTTTGCTACTTTGGATGAAGCTGTT
AAGATAACCAACAGGCGTGTAAACCCCATCGAACATGACAACCTTCCCCAGACTGGACAC
GCCCTTGCCTGTAGCATCACAGAGCTGGATAAGAGACAACAAGACTTCTAGAGGTTAAAG
AAAACACAGAAGAAGGAAAAGATTCTCCAGGAAAAATCTGAGCAGGACTTGGCACAGCGG
AGGGTGGCTGGAGGGGCGAGGGAGCCCACTGATGGGCTGGCTGGAGAGAAGCACAGAACT
CTTCTGTTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KDNVAGVTLPVFEHYHEGTDSYELTGLARGGEQLAKLKRNYAKAVELLVELASLQTSFVTLDEAIKITNRRVNAIEHVIIPRIERTLAYIITELDERERE
.DN..G....VFEH.HEGTDSY.LTGLAR.G.....LKRN.A.A....V..AS..TSF.TLDEA.KITNRRVN.IEH...P.....LA..ITELD.R...
Retrocopy
EDNATGDNF-VFEHHHEGTDSYKLTGLARSGDHASELKRNNAQA----VGAASKRTSFATLDEAVKITNRRVNPIEHDNLPQTGHALACSITELDKRQ-Q


Parental protein
EFYRLKKIQEKKKILKEKSEKDLEQRRAAGEVMEPANLLAEEKDEDLLF
.F.RLKK.Q.K.KIL.EKSE.DL.QRR.AG...EP...LA.EK...LLF
Retrocopy
DF*RLKKTQKKEKILQEKSEQDLAQRRVAGGAREPTDGLAGEKHRTLLF


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide