RetrogeneDB ID:
retro_mputfur_1382
Organism:
Location:
GL897106.1:93938-94282 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.93 %
Coverage:
51.8 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
SOD2
Parental gene aliases:
No gene alias available
Parental gene description:
superoxide dismutase 2, mitochondrial [Source:HGNC Symbol;Acc:11180]

Genomic region (view in browser)





>retro_mputfur_1382
AGTAACTTGAAAGCTACCAAGGAGAAATTTAAAGAGGACTTGGCAAAAGGCATTGTTACA
ATTCAGGTATCTCTTCAGCTTGCATTAGTTTCAGTGGTGGAGGCCATAACGCTCTTACCA
TTTTAAGAACAAACCTAAACCCTAATGATGGTGAAGAATGCTAAGGGCTGTTACTGGAAG
CCAACAAACGTTACTTTGTTTCCTCTGACTTATTTAAGGAGAAGTTGACAGCTGTATCTG
TTAGCATTCAAGGGTCAGATTGGGGTTGACTTGGTTTCATTAAGTAATAAGGACACTTAC
AAATTGCTGCCGGTTCTAATCAGGATCCATTGCAAGGAACCACA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NNLNAVEEKYLEALEKGDVTTQVALQPGL-KFNGGGHINHSIFWTNLSPKGGGEPKGELLEAIKRDFGSFDKFKEKLTAVSVGVQGSGWGWLGFNKEQGR
.NL.A..EK..E.L.KG.VT.QV.LQ..L..F.GGGH....I..TNL.P..G.E..G.LLEA.KR.F.S.D.FKEKLTAVSV..QGS.WG.LGF.K..G.
Retrocopy
SNLKATKEKFKEDLAKGIVTIQVSLQLAL/SFSGGGHNALTILRTNLNPNDGEEC*GLLLEANKRYFVSSDLFKEKLTAVSVSIQGSDWG*LGFIK**GH


Parental protein
LQIAACSNQDPLQGTT
LQIAA.SNQDPLQGTT
Retrocopy
LQIAAGSNQDPLQGTT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide