RetrogeneDB ID:
retro_mputfur_139
Organism:
Location:
GL897380.1:168217-168931 (+)
Status:
KNOWN_PROTEIN_CODING
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
75.11 %
Coverage:
87.02 %
Frameshifts:
0
Stop codons:
0


Parental gene:
Parental gene symbol:
SPIN1
Parental gene aliases:
No gene alias available
Parental gene description:
spindlin 1 [Source:HGNC Symbol;Acc:11243]

Genomic region (view in browser)





>retro_mputfur_139
GGCGTCTCTGCATACCTGATGAAGAAAAGGCACACCCACAGGAAGCAGCGGCGCAAGCCC
ACTTTCCTCACGCGTAGGAACATCGTGGGCTGCCGCATTCAGCACGGCTGGAAGGAAGGC
AATGAGCCCGTGGAGCAGTGGAAGGGCACTGTGCTCGAGCAGGTTTCCGTGAAGCCCACT
CTCTACATCATCAAATATGATGGCAAAGATAGTGTGTATGGGCTAGAGCTGCACCTAGAT
AAGAGAGTTTTAGCGTTAGAAATCCTTCCTGAAAGAGTGCCAACTCCTCACATTGATTCG
CGCCTGGCGGATTCCCTGATTGGCAAAGCAGTGGGGCATGTGTTTGAGGGTGAGCATGGT
ACGAAAGATGAATGGAAGGGCATGGTTCTGGCGCGAGCTCCTGTGATGGACACTTGGTTT
TATATAACTTATGAGAAAGATCCTGTCCTTTATATGTACACGCTGCTGGATGACTACAAA
GACGGTGACCTGCGCATCATTCCAGATTCCAACTACTACTTCCCTACAGCAGAACGGGAG
CCTGGAGAAGTGGTCGACAGCCTCGTGGGCAAGCAAGTGGAACACGCCAAAGATGACGGG
TCCAAGAGAACCGGCATATTTATCCATCAAGTGGTGGCCAAGCCATCCGTCTACTTCATT
AAGTTTGATGATGATATTCACATTTATGTCTATGGCTTGGTGAAAACCCCCTAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
KKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMI
K.H.......KP....RRNIVGCRIQHGWKEGN.PV.QWKGTVL.QV.V.P.LY.IKYDG.D.VYGLEL..D.RV.ALE.LP.RV.T..I.D..LAD..I
Retrocopy
KRHTHRKQRRKPTFLTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHLDKRVLALEILPERVPTPHI-DSRLADSLI


Parental protein
GKAVEHMFETEDGSKDEWRGMVLARAPIMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSN-DSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMV
GKAV.H.FE.E.G.KDEW.GMVLARAP.M.TWFYITYEKDPVLYMY.LLDDYK.GDLRI.PDSN...P.AEREPGEVVDSLVGKQVE.AK.DGSKRTG..
Retrocopy
GKAVGHVFEGEHGTKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEREPGEVVDSLVGKQVEHAKDDGSKRTGIF


Parental protein
IHQVEAKPSVYFIKFDDDFHIYVYDLVKT
IHQV.AKPSVYFIKFDDD.HIYVY.LVKT
Retrocopy
IHQVVAKPSVYFIKFDDDIHIYVYGLVKT


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide