RetrogeneDB ID:
retro_mputfur_1390
Organism:
Location:
GL897107.1:879115-879667 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
72.34 %
Coverage:
100.0 %
Frameshifts:
2
Stop codons:
1


Parental gene:
Parental gene symbol:
ARL8B
Parental gene aliases:
No gene alias available
Parental gene description:
ADP-ribosylation factor-like 8B [Source:HGNC Symbol;Acc:25564]

Genomic region (view in browser)





>retro_mputfur_1390
GCACTCATCTCCCACCTGCTGGACTGGTTTTGCTCGCTCTTCTGGAAGGAGGAGATGGCA
CTGACGCTGGTGGGGCTGCAGTACTCGGGCAAGACCATCTTCATCCATGTCAGCACATCA
GGTCAGTTCAGTGAGGATAGGATACCCACAGTGGGCTTTAACATGGGGAAAGTAACTAAA
GGTAACATCACAAGAAAGATTTGGGACATAGGAGGACAACCCCAGTTCCGGAGCATGTGA
GAACAGTACTGCAGGGGAGTCAATGCCATTGTTTACATGACAGATGCTGCTGATCGTGAA
AAGATAGAAGACTCTCAAAATGAACTACATCATCTTCTAGATAAGCCACTGTTACAAGGA
ATTCTAGTGCTAGTACTTGGAAGCAAGAGAGAGCTTCCTAAGACCTTGGATGAGAAACAA
CAAACTGAAAAAAATGAACCTATCTGTTATTCAGGACAGAGGAATTTGCTGCTACTCAAT
TTCTTGCAAAGAAAAGGAAAACATAGATATCACACTTCAGTGGCTTATTCAACATTAAAA
TCTAGAAGAAGC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SLCSGLVDSFRIILFGTFPTLLTLIYRWEMNKFSFIVVIFQSGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAAD
.L.S.L.D.F...LF......LTL.......K..FI.V...SGQFSED.IPTVGFNM.KVTKGN.T.KIWDIGGQP.FRSM.E.YCRGVNAIVYM.DAAD
Retrocopy
ALISHLLDWF-CSLFWKEEMALTLVGLQYSGKTIFIHVS-TSGQFSEDRIPTVGFNMGKVTKGNITRKIWDIGGQPQFRSM*EQYCRGVNAIVYMTDAAD


Parental protein
REKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIE-KMNLSAIQDREICCYSISCKEKDNIDITLQWLIQH-SKSRRS
REKIE.S.NELH.LLDKP.LQGI.VLVLG.KR.LP..LDEKQ..E.KMNLS.IQDR.ICCYSISCKEK.NIDITLQWLIQH..KSRRS
Retrocopy
REKIEDSQNELHHLLDKPLLQGILVLVLGSKRELPKTLDEKQQTE\KMNLSVIQDRGICCYSISCKEKENIDITLQWLIQH/LKSRRS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide