RetrogeneDB ID:
retro_mputfur_1392
Organism:
Location:
GL897108.1:2892985-2893365 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
62.69 %
Coverage:
59.09 %
Frameshifts:
4
Stop codons:
2


Parental gene:
Parental gene symbol:
ANP32B
Parental gene aliases:
No gene alias available
Parental gene description:
acidic (leucine-rich) nuclear phosphoprotein 32 family, member B [Source:HGNC Symbol;Acc:16677]

Genomic region (view in browser)





>retro_mputfur_1392
ATGGATGTGGAGAGGAACCTGGAGCCGAGGCGTCTGACACCCTAAGCTGCTGGAAAACTT
GTCCAGACAACTGCAGATCAAATAATGGGAACATTGCGGGCTCAACACTGAATTTGTGAA
CTTAGAGTTGCTCAGTTTCATAAATGCAGCTTGATTTCAGTTTCACATCACCCCCAGCTA
CCTAAATTGAAAAAGCTTGAGCTCAGTGACAGTAGCATCTTTGGAGGTCTGGACGTGTTA
GGAGAAAACCTTTCAAATCTCACCCATCGGAACGTCAGCGCATTCTACTGCAAAATATCA
GCACCTTGGAACCTTTGAAAAAGTGAGAATGTCTGAAAACCCCGAACCTGTTTAACTGTG
GGGTTACTAGTCTGAATGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MDMKRRIHLELRNRTPAAVRELVL-DNCKSNDGKIEG-LTAEFVNLEFLSLINVG-LISVSNLPKLPKLKKLELSDNRIFGGLDMLAEKLPNLTHLNLSG
MD..R...LE.R..TP.A...LV..DNC.SN.G.I.G.L..EFVNLE.LS.IN...LISVS..P.LPKLKKLELSD..IFGGLD.L.E.L.NLTH.N.S.
Retrocopy
MDVER--NLEPRRLTP*AAGKLVQ/DNCRSNNGNIAG/LNTEFVNLELLSFINAA/LISVSHHPQLPKLKKLELSDSSIFGGLDVLGENLSNLTHRNVSA


Parental protein
-NKLKDISTLEPLKKLEYLKSLDLFNCEVTNLND
...L..ISTLEPLKK.E.LK...LFNC.VT.LND
Retrocopy
/ILLQNISTLEPLKK*ECLKTPNLFNCGVTSLND


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide