RetrogeneDB ID:
retro_mputfur_1397
Organism:
Location:
GL897112.1:681829-682524 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
74.25 %
Coverage:
66.29 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
MTHFD2
Parental gene aliases:
No gene alias available
Parental gene description:
methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, methenyltetrahydrofolate cyclohydrolase [Source:HGNC Symbol;Acc:7434]

Genomic region (view in browser)





>retro_mputfur_1397
ATGGCTGCTGCTTCCCTCGTGCCCATATTGGCCACCCAGGTGCTCTGGACCACACAGAAC
TGCCCATCTGCCATCACCCCTTCCACCTCTTGGTAGTTGAAAATGAAGCTGTTGTCACTT
TTGGAAGGAAACTTGCCTGGCAGATCAAGCAGGAAATGCAGCAGGAGGTGGAAGAATGTG
TGGCATCAGGTGACAAGCAACCACACCGGAGTGTGGTTCTGGTTGATGAGAAGCCTGTAG
GTCACTCCTATGTCCTCTACAAAACCAAGGCAGCTGCAGAAGTGGGAATTGACAGTGAGA
CAATTGTGAAACCAGCTTCAATTTCTGAGGAAGAACTGTTGAATTTAATCAATAATCTAA
ATAATGATGGTAATGCAGTTGGCCTCCTTGTTCAGCTGCCTCTTCCAGAGCACAGTGAGG
AGAGAAAGATCTGCAATGCTGTTTCTCCAGACAAGGATGTTGGTGGCTTTCATGTAATTC
ATGTAGGGCAAATGTGTTTGGACCAGTATTCCATATTATCGGCTACCCCACGGAGTGTCT
GGAAAATAATTAAATGAACTAGCACTCCAACCCTACGGAAGAATGTGGTTGTGGCTGGGA
AGTCAAAAAATGTTGGAATGCCCGTTGCAATGCTACTACACACAGATGGGGCACATGAAT
GCCCTAGAGGTGATGCCACTCTTATAATATCTCAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MAAVSVVSTLAIRLLRPAQSCR-LRHRPFHLSVVRNEAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVVLVGENPASHSYVLNKTRAAAEVGINS
MAA.S.V..LA...L...Q.C....H.PFHL.VV.NEAVV..GRKLA.QIKQE..QEVEE.VASG.K.PH.SVVLV.E.P..HSYVL.KT.AAAEVGI.S
Retrocopy
MAAASLVPILATQVLWTTQNCP/ICHHPFHLLVVENEAVVTFGRKLAWQIKQEMQQEVEECVASGDKQPHRSVVLVDEKPVGHSYVLYKTKAAAEVGIDS


Parental protein
ETIVKPASVSEEELLNLINKLNNDDDVDGLLVQLPLPEHIDERKICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWEIIKRTGIPTLGKNVVVA
ETIVKPAS.SEEELLNLIN.LNND....GLLVQLPLPEH..ERKICNAVSPDKDV.GFHVI.VG.MCLDQYS.L.ATP..VW.IIK.T..PTL.KNVVVA
Retrocopy
ETIVKPASISEEELLNLINNLNNDGNAVGLLVQLPLPEHSEERKICNAVSPDKDVGGFHVIHVGQMCLDQYSILSATPRSVWKIIK*TSTPTLRKNVVVA


Parental protein
GRSKNVGMPIAMLLHTDGAHERPGGDATVTISH
G.SKNVGMP.AMLLHTDGAHE.P.GDAT..ISH
Retrocopy
GKSKNVGMPVAMLLHTDGAHECPRGDATLIISH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide