RetrogeneDB ID:
retro_mputfur_1398
Organism:
Location:
GL897112.1:911495-912031 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
72.78 %
Coverage:
67.94 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
NMNAT3
Parental gene aliases:
No gene alias available
Parental gene description:
nicotinamide nucleotide adenylyltransferase 3 [Source:HGNC Symbol;Acc:20989]

Genomic region (view in browser)





>retro_mputfur_1398
AGTGAGCAGTTGCAGTGGATGAAGACAGGGAAGGTGCTAAGGCATCGTCACAGAAAACTG
CTTAGATCTCTGCCCCAGACAGAGGGCCTGGAACATGGCAGGGCTCACTCTACAGCCCCC
ACAGCTGGGCCTAAGCTGAAGCCCTTCTACAGGGCAGATGTCCTAAAGACCTTCCAGAAC
CCAACCTCTGGAAAGACGCACACATCCAGGAGATAGTGGAGAAGTTTGGTGTGGCATGTG
TGATCTAGACAGGTCACAAGGCAAAGGAATACCTCTCGGGCTCACCCGTCCTGCCCAGGT
ACCCACACAACATTCACCTGGCCAGGGAGCCCGTGCAGAGTGAGCTCAGCTCTGCATACA
TCAGGCGGGCCTTGAGCCAGGGGCATAGCGTGAGGAACCTGCTCCCAGATGCTGTCATCA
CCTACATCAAGGACCATAACTTCTACACCAGGGACAGTTCATGGAAAGGCAGGGGCACCC
AGACAAATGAAAGAAAGACAAGCTGGAGAGAACCAGCCACTCCTCCACAGAGTTCC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
SEQLQWTETVKVLRHHHSELLRSLPRREGPDHSRAR-TAPTAVPELKLLCGADVLKTFQT-PNLWKDAHIQEIVEKFGVVCVSRTGHNPKEYISGSPILH
SEQLQW..T.KVLRH.H..LLRSLP..EG..H.RA..TAPTA.P.LK....ADVLKTFQ..PNLWKDAHIQEIVEKFGV.CV..TGH..KEY.SGSP.L.
Retrocopy
SEQLQWMKTGKVLRHRHRKLLRSLPQTEGLEHGRAHSTAPTAGPKLKPFYRADVLKTFQN/PNLWKDAHIQEIVEKFGVACVI*TGHKAKEYLSGSPVLP


Parental protein
RYRHNIHLAREPVQNELSSTYVRQALSQGHSVKYLLPDAVITYIRDHNLYTRDSSWKGSSTQRSEGKTGWEESASPQNSS
RY.HNIHLAREPVQ.ELSS.Y.R.ALSQGHSV..LLPDAVITYI.DHN.YTRDSSWKG..TQ..E.KT.W.E.A.P..SS
Retrocopy
RYPHNIHLAREPVQSELSSAYIRRALSQGHSVRNLLPDAVITYIKDHNFYTRDSSWKGRGTQTNERKTSWREPATPPQSS


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide