RetrogeneDB ID:
retro_mputfur_1404
Organism:
Location:
GL897116.1:1853260-1853616 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
67.48 %
Coverage:
92.31 %
Frameshifts:
3
Stop codons:
2


Parental gene:
Parental gene symbol:
RPS15A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein S15a [Source:HGNC Symbol;Acc:10389]

Genomic region (view in browser)





>retro_mputfur_1404
ATGGTGCACATGAATGTCCTGGCAGATGCTCTCAAGAGCATTAATGATCTGAAAAGAGAG
ACAAACTCTAGGTTCTTAATAGGCCATACTCCAAAGTCATCGTCTGGTTTCTAACTAAAA
CGATGAAGCATGATTACTTTAGTGAATTTGAAATCACTAATAAGCAAAGAGCTTGGAAAT
TGTTGTGAACCTCATGGAAAGGTTAAACAAGTGTGGAATGATCCACTTCAGATTTGAGGT
ACAACTCAAAGATCTAAAAACATGGAAAAATAATCTGCTTCTGCCCCATCAGTTTGGTTT
CACTGTACTCAACAACAGCTGGTATCAAAGACCATGAAGAAGCAAAATGAAAATAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MVRMNVLADALKSINN-AEKRGKRQVLIRPCSKVIVRFLTVMMKHGYIGEFEIIDDHRAGK-IVVNLTGRLNKCGVISPRFDVQLKDLEKWQNNLLPSRQ
MV.MNVLADALKSIN...EKR.K..VL.RP.SKVIV.FLT..MKH.Y..EFEI....RA.K.IVVNL..RLNKCG.I..RF.VQLKDL..W.NNLL...Q
Retrocopy
MVHMNVLADALKSIND/SEKRDKL*VLNRPYSKVIVWFLTKTMKHDYFSEFEITNKQRAWK/IVVNLMERLNKCGMIHFRFEVQLKDLKTWKNNLLLPHQ


Parental protein
FGFIVL-TTSAGIMDHEEARRKH
FGF.VL.TT.AGI.DHEEA..K.
Retrocopy
FGFTVL\TT-AGIKDHEEAK*KY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide