RetrogeneDB ID:
retro_mputfur_1405
Organism:
Location:
GL897116.1:1064836-1065191 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
75.83 %
Coverage:
55.61 %
Frameshifts:
1
Stop codons:
1


Parental gene:
Parental gene symbol:
RPL10
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L10 [Source:HGNC Symbol;Acc:10298]

Genomic region (view in browser)





>retro_mputfur_1405
AGGATACAACTCCACCCCTTCCACATCATTTGTATCAACAAGATGTTATCCTGTACTGGG
GCGGACAGGTTCCAGACTAGGTATGTGTGATGCTTTTGGAAAGCCCCAGGGCACAGTGGC
CAGGGCCCACACTGGCCAAGCCATCATGTCCATCCATACCAAGCTGCTGAAGAAGGAACA
TGTAATTGAGGCCCTGTGAAGGGCCAGGTTCAAGTTCTCTGGCCACCAAAAAATCCACAT
TTACAAGAAGTGGGGCTTTACTAAGTTTAATATGTATGAAGAAGACATGGTAGCTGAAAA
GTGGCTCATGGCAGATGGCTATGGGGTCAAATACATCCCCAATCCTGGCTCCTTG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RVRLHPFHVIRINKMLSCAGADRLQT-GMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVA
R..LHPFH.I.INKMLSC.GADR.QT.GM..AFGKPQGTVAR.H.GQ.IMSI.TKL..KEHVIEAL.RA.FKF.G.QKIHI.KKWGFTKFN..E.EDMVA
Retrocopy
RIQLHPFHIICINKMLSCTGADRFQT\GMCDAFGKPQGTVARAHTGQAIMSIHTKLLKKEHVIEAL*RARFKFSGHQKIHIYKKWGFTKFNMYE-EDMVA


Parental protein
EKRLIPDGCGVKYIPNRGPL
EK.L..DG.GVKYIPN.G.L
Retrocopy
EKWLMADGYGVKYIPNPGSL


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide