RetrogeneDB ID:
retro_mputfur_1408
Organism:
Location:
GL897117.1:1340157-1340556 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
65.67 %
Coverage:
77.78 %
Frameshifts:
0
Stop codons:
3


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
No gene description available

Genomic region (view in browser)





>retro_mputfur_1408
TTTCAAAACTACTTAAGGTTAGATGTACAGTGATCTCCTTAGGAAGGAAAGAATGGCATT
TTACATATATTAGGCAGAAATAAGAGAATCAAACCCTGGCCAGAAATGTTCCAGAACAGC
AAAGGTGTATTTGATTTGCTGCTACTCATTTGTGAAGAGAGAGCGAATGACCAGATGGTT
GAAGATCGGAATTCCAGAGAGCAGGAGACCTGCCAACCCATGCCTGTAAGCAATGAGGAC
ATCCAGAACAGTGACAGAGAGGCCACCCTGGGGGCATTCTTCATCTGTGAGCTATGCCAG
TGCATTCAGTGTAGGGAGGATGTGGAGAATTAAATGGATGAGCTGCTGCAGGAGTTGGAG
GAGAGTTCCAGGGCTTTCCTGCACACAGTTTCCTTCTAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
YNDLLRKDKELSLSYTQNGILHMLDRNKRIKPRPERFQNCRDLFDLILT-CEERVYDQVVEDLNSREQETCQPVHVINVDIQDNHEEATLGAFLICELCQ
....LR.D...S.....NGILH.L.RNKRIKP.PE.FQN....FDL.L..CEER..DQ.VED.NSREQETCQP..V.N.DIQ....EATLGAF.ICELCQ
Retrocopy
FQNYLRLDVQ*SP*EGKNGILHILGRNKRIKPWPEMFQNSKGVFDLLLLICEERANDQMVEDRNSREQETCQPMPVSNEDIQNSDREATLGAFFICELCQ


Parental protein
CIQHTEDMENEIDELLQEFEEKSGRAFLHTVCFY
CIQ..ED.EN..DELLQE.EE.S.RAFLHTV.FY
Retrocopy
CIQCREDVEN*MDELLQELEE-SSRAFLHTVSFY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide