RetrogeneDB ID:
retro_mputfur_1409
Organism:
Location:
GL897118.1:2162274-2162729 (+)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
62.82 %
Coverage:
60.63 %
Frameshifts:
2
Stop codons:
3


Parental gene:
Parental gene symbol:
PGAM1
Parental gene aliases:
No gene alias available
Parental gene description:
phosphoglycerate mutase 1 (brain) [Source:HGNC Symbol;Acc:8888]

Genomic region (view in browser)





>retro_mputfur_1409
TCAAAAACTGCTGCCAAGCATGGCAAAGCCCAGGTAAAGATCTGGACATGCCCTTATGAT
GTCCCACCACCTGAGATGGAGCCTGACATTCCACAGCAACATCAGTAAGGCTCACAAGTG
TGCAGAGCTCACTGAATATCAGCTATCCTCCTGTGATTGATTGATGTACACCATTGCCAG
AATTCTGCCCTTTTGAAATGAAGAAATACCCCCAGATCAAGGAGGGAAAATAGGTACATA
TTGCAGCCTATGGCAACAGCCTTCTGTACATTGTCAGGTGTCTGGAGGATCTTTCCAAAG
AGGCTATCTCGGAGCTGCAGCTGCCAATTGGTATTCCCATGGTATAAGAATTGGACAGGA
ATTTGAAGCCCATCATGCCCATGCAGTTCCTAGGGAATGAAGAAGCAGTGGGAAAAGCCA
TAGAAGCTTCAACTGCCCAGCACAAAGCTAAAGAG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AETAAKHGEAQVKIWRRSYDVPPPPMEPDHP-FYSNISKDRRYADLTEDQLPSCESLKDTIARAL-PFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLE
..TAAKHG.AQVKIW...YDV..PP.E.....F.SNISK....A.LTE.QL.SC..L..TIAR.L.PF......PQIKEGK.V.IAA.GNSL..IV..LE
Retrocopy
SKTAAKHGKAQVKIWTCPYDV--PPPEMEPD\FHSNISKAHKCAELTEYQLSSCD*LMYTIARIL\PFEMKKY-PQIKEGK*VHIAAYGNSLLYIVRCLE


Parental protein
GLSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK
.LS.EAI.EL.LP.GIP.V.ELD.NLKPI.PMQFLG.EE.V.KA.EA..AQ.KAK.
Retrocopy
DLSKEAISELQLPIGIPMV*ELDRNLKPIMPMQFLGNEEAVGKAIEASTAQHKAKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide