RetrogeneDB ID:
retro_mputfur_1411
Organism:
Location:
GL897118.1:2335376-2336604 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
91.06 %
Coverage:
99.76 %
Frameshifts:
4
Stop codons:
5


Parental gene:
Parental gene symbol:
No gene symbol available
Parental gene aliases:
No gene alias available
Parental gene description:
SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 [Source:UniProtKB/TrEMBL;Acc:G9KQ49]

Genomic region (view in browser)





>retro_mputfur_1411
TCAAAAAGACCATCTGATGCCCCACCTCCCACCCCAGCTCCTGAAACACAAATGCCCAGC
ACACCAGGGTTTGTGAGATACAATCCATACAGTCATCTCGCCTACAACAACTACAGGCCT
GAGGGAACCCGGCACCAACAGCCGGGTCATGGCATCCTCTGGTATTACAATTCCAAAACC
CCAAAGTGACCAGATAAGCCACTGATGCCCTACATGAGGTACAGCAGAAAGGTCTGGGAC
CAAGTAAAAGCTTCCAACCCTGACCTAAAGTTGTGGGAGATTGGCAAGATTATTGGTGGC
ATGTGGCGAAATCTCACTGATGAAGACAAACAAGAATAATTAAACGAATACGAAGCAGAA
AAGATAGAGTACAATGAATCTATGAAGGCCTATCATAATTCCCCCACATACCTTGCTTAC
ATAAATGCAAAAAGTCGTGCAGAAGCTGCTTTAGAGGAAGAAAGTCAACAGAGACAGTCT
TGCATGGAGAAAGAAGAGCCGTACATGAGCATCCAGCCTGCTGAAGATCCAGACGGTTAT
GATGATGGCTTTTCAATGAAGCATACAGCCACCGCCCGTTTTCAGAGAAACCACCACCTC
ATCAGTGAAATCCTCAGTGAGAGTGTGATGCCAGATGTTCGGTCAGTTGTCACAACAGCT
AGAGTGCAGGTCCTCAAACGACAGGTCCAGTCCTTAATGGTTCATCAGCGAAAACTAGAA
GCTGAACTTCTTCAAATAGAGGAGTGACACCAGGAAAAGAAGAGGAAATTCCTGGAAAGC
ACAGATTCATTTAACAATGAACTTAAAAGGTTGTGCGGTTTAAAAGAATAAGTGGATATG
GAAAAAATTGCTGCTGAAATTGCACAGGCAGAGGAGCAGGCTCGGAAAAGGCAGGAGGAA
AGAGAGAAAGAGGCAGCAGAGCAAGCTGAACGCAGTCAGAGCAGCATGGTTCCTGAGGAA
GAGCAAGCTGCGAGTAAGACCGAAGAGAAGAAGGACAACGAGAGCATCCCAATGGAGACA
GAGGAGACACACCTTGAAGAAGCGACAGAAAGCCAACAGAATGGTGAAGAAGGCACATCT
ACTCCAGAGGACAAGGAGAGCGGGAAGGAGGGGGTGGGACAGTATGGCTGAGGAAGGGAC
CAGTGATAGTAACACTGGCTGGGAGAGCAACAGTGCCACCATGGAGGAGCCGCCAACAGA
CCCCGCCCCAGAAGAGGAGAAGAAAGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
TERPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYR-LGGNP-GTNSRVTASSGITIPKP-PKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGK
..RPS.APPPTPAP.TQMPSTPGFV.YNPYSHLAYNNYR...GNP.GTNSRV.ASSGITIPKP.PK.PDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGK
Retrocopy
SKRPSDAPPPTPAPETQMPSTPGFVRYNPYSHLAYNNYR/A*GNP/GTNSRVMASSGITIPKP/PK*PDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGK


Parental protein
IIGGMWRDLTDEEKQEYLNEYEAEKIEYNESMKAYHNSPAYLAYINAKSHAEAALEEESRQRQSRMEKGEPYMSIQPAEDPDDYDDGFSMKHTATARFQR
IIGGMWR.LTDE.KQE.LNEYEAEKIEYNESMKAYHNSP.YLAYINAKS.AEAALEEES.QRQS.MEK.EPYMSIQPAEDPD.YDDGFSMKHTATARFQR
Retrocopy
IIGGMWRNLTDEDKQE*LNEYEAEKIEYNESMKAYHNSPTYLAYINAKSRAEAALEEESQQRQSCMEKEEPYMSIQPAEDPDGYDDGFSMKHTATARFQR


Parental protein
NHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARK
NH.LISEILSESV.PDVRSVVTTAR.QVLKRQVQSLMVHQRKLEAELLQIEE.HQEKKRKFLESTDSFNNELKRLCGLK..VDMEKIAAEIAQAEEQARK
Retrocopy
NHHLISEILSESVMPDVRSVVTTARVQVLKRQVQSLMVHQRKLEAELLQIEE*HQEKKRKFLESTDSFNNELKRLCGLKE*VDMEKIAAEIAQAEEQARK


Parental protein
RQEEREKEAAEQAERSQSSMVAEEERAASKTEEKKDDESVPTETEETHLEEATESQQNGEEGTSTPEDKESGQEGV-DSMAEEGTSDSNTGSESNSATVE
RQEEREKEAAEQAERSQSSMV.EEE.AASKTEEKKD.ES.P.ETEETHLEEATESQQNGEEGTSTPEDKESG.EGV.DSMAEEGTSDSNTG.ESNSAT.E
Retrocopy
RQEEREKEAAEQAERSQSSMVPEEEQAASKTEEKKDNESIPMETEETHLEEATESQQNGEEGTSTPEDKESGKEGV\DSMAEEGTSDSNTGWESNSATME


Parental protein
EPPTDPAPEDEKKE
EPPTDPAPE.EKKE
Retrocopy
EPPTDPAPEEEKKE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide