RetrogeneDB ID:
retro_mputfur_1412
Organism:
Location:
GL897118.1:2954873-2955224 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
69.23 %
Coverage:
90.7 %
Frameshifts:
0
Stop codons:
5


Parental gene:
Parental gene symbol:
COX5B
Parental gene aliases:
No gene alias available
Parental gene description:
cytochrome c oxidase subunit Vb [Source:HGNC Symbol;Acc:2269]

Genomic region (view in browser)





>retro_mputfur_1412
GCCCTGCAAGCCTTCAGGGCCTGCCATCTCAATTGAATTGCTTCAGTGTGCTCCATGACC
TCTGGAGGTGGTGTTCTTACTGCTGACCAGCAGGTTCCTGGGCTGGAAAGGGAAGTCATG
ATGGCTGCATGGAAGGGACTGTACTAATATATTATGTTAGCCCCAAGGGCAGCTTTAGGC
ACCAAGGAAGATTAGAATTTAGTCCCATCTATCACCAACAAGTGAACAGAGGCTTGCATC
TGTGAAGAGGACAATAGTGCCATCATCTGGTTCTGGCTGCACAAAGGAGAGACCCAGTGA
TGCCCTAGCTGTGGAATCCATTATAAGCTGTTGTCCCACCAGTTGGCCCAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
AAQAFRARGPNGVAAVRTMASRGGIPTDDDQATGLEREVMMAARKGLDPYNLLAPKAAAGTKEDPNLVPSITNKRIVGCICEEDNSTVIWFWLHKGEAQR
A.QAFRA...N..A.V..M.S.GG..T.D.Q..GLEREVMMAA.KGL..Y..LAP.AA.GTKED.NLVPSITNK....CICEEDNS..IWFWLHKGE.Q.
Retrocopy
ALQAFRACHLN*IASVCSMTSGGGVLTADQQVPGLEREVMMAAWKGLY*YIMLAPRAALGTKED*NLVPSITNK*TEACICEEDNSAIIWFWLHKGETQ*


Parental protein
CPSCGTHYKLVPHQLAH
CPSCG.HYKL..HQLAH
Retrocopy
CPSCGIHYKLLSHQLAH


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide