RetrogeneDB ID:
retro_mputfur_1413
Organism:
Location:
GL897119.1:811911-812207 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
58.82 %
Coverage:
63.52 %
Frameshifts:
1
Stop codons:
6


Parental gene:
Parental gene symbol:
C9orf85
Parental gene aliases:
No gene alias available
Parental gene description:
chromosome 9 open reading frame 85 [Source:HGNC Symbol;Acc:28784]

Genomic region (view in browser)





>retro_mputfur_1413
AGGTCCCAGGGTAATTTTAGCTTCAAAAATGATAAGTTGGATAGGAGTGTCCAGACCAAG
AAAATTAAGGCAAACCTTCATAATGGAGTATGTCAGCACTGTAAATAAGTTCTTGAATGA
TGTGCAAAACACAGCAAATACAAGCCATTTTTAAGCCTTAAAAATGTGTTAAATATTTAC
AAAAGACAGTGAAGTACTGTTATAACATGTAGACCATGTGCCTGTGAACGTGAAGGTTGT
GTAAAGGGTGTAAAAAAGAAGACACTGTTATTCTGTTTCATAAAGAAACAGAAAGG


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
RHQNTFSFRNDKFDKSVQTKKINAKLHDGVCQRCKEVLEWRVKYSKYKP-LSKPKKCVKCLQKSVKDSYHIMCRPCACELDVCAKCGKKEDIVIPFNKEP
R.Q..FSF.NDK.D.SVQTKKI.A.LH.GVCQ.CK.VLE...K.SKYKP...KP.KCVK.LQK.VK..Y..M...C......C..C.KKED.VI.F.KE.
Retrocopy
RSQGNFSFKNDKLDRSVQTKKIKANLHNGVCQHCK*VLE*CAKHSKYKP/IFKP*KCVKYLQKTVKYCYN-M*TMCL*T*RLCKGC-KKEDTVILFHKET


Parental protein
EK
E.
Retrocopy
ER


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide