RetrogeneDB ID:
retro_mputfur_1418
Organism:
Location:
GL897122.1:2522089-2522481 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
68.42 %
Coverage:
65.02 %
Frameshifts:
1
Stop codons:
4


Parental gene:
Parental gene symbol:
RPL13A
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L13a [Source:HGNC Symbol;Acc:10304]

Genomic region (view in browser)





>retro_mputfur_1418
TACTTCCAAGCACATAACCACATATTTTGCCAGACAGTGCAAGGCATGCTGCCGCACAAG
ACCAAGTAAGGTCAGGCTTTCCTGAACCACCTCAAGGTGTTTGTTGGGATACTGCTACCC
TATGACAATAAAAAGTGAATGGTGGTTTCTGCTGCCCTCAAGGTTGTGCATCTGAAACCT
ACAGAAACGTTTGCTTACCAGGGCCACCTGGCTCATGAGGTTGCCTGGAAGCACCAGGCA
ATAATAGCCACCCTGGAGGAGAAGAGGAAGGAATAGGCCAAGAGCCATTATTAGAAGAAA
AAGCAGCTTGTGAGGCTATGGAAACAGTCCAAAAAGACATGAAGAAAATTGACAAGTACA
GAGAAGTCTTCAAGACCCACAGACTTCTGGTC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
HFRAPSRIFWRTVRGMLPHKTKRGQAALDRLKVFDGIPPPYDKKKRMVVPAALKVVRLKPTRKFAYLGRLAHEVGWKYQAVTATLEEKRKEKAKMHYRKK
.F.A...IF..TV.GMLPHKTK.GQA.L..LKVF.GI..PYD.KK.MVV.AALKVV.LKPT..FAY.G.LAHEV.WK.QA..ATLEEKRKE.AK.HY.KK
Retrocopy
YFQAHNHIFCQTVQGMLPHKTK*GQAFLNHLKVFVGILLPYDNKK*MVVSAALKVVHLKPTETFAYQGHLAHEVAWKHQAIIATLEEKRKE*AKSHY*KK


Parental protein
KQLMRLRKQA-EKNVEKKIDKYTEVLKTHGLLV
KQL.RL.KQ...K...K.IDKY.EV.KTH.LLV
Retrocopy
KQLVRLWKQS/QKDMKK-IDKYREVFKTHRLLV


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide