RetrogeneDB ID:
retro_mputfur_1419
Organism:
Location:
GL897124.1:229403-230240 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
93.21 %
Coverage:
99.64 %
Frameshifts:
0
Stop codons:
1


Parental gene:
Parental gene symbol:
MAP2K4
Parental gene aliases:
No gene alias available
Parental gene description:
mitogen-activated protein kinase kinase 4 [Source:HGNC Symbol;Acc:6844]

Genomic region (view in browser)





>retro_mputfur_1419
GTCCACAAACCAAGTGGGCCAATGATGGCAGTTAAAAGAGTTTGGTCAACAGTGGATGAG
AAAGAACAAAACCAACTTCTTATGAATTTGGATGTAGTAATGCAGAGTAGTGATTGCCCG
TACATTGTTCAGTTTTATGGTGCACTCTTCAGAGGGGGTGACTGTTGGATCTGTATGGAA
CTCATGTCTACCTCGTTTGATAAGTTTTACAAATATGTATATAGTGTATAAGATGATGTT
ATTCCAGAAGAAATTTTAGGTAAAATCACTTTAGCAACTGTGAAAGCACTAAACCACTTA
AAAGAAAACTTGAAAATCATTCACAGAGATATAAAACCTTCTAATATTCTTCTGGACAGT
GGAAATATTAAGCTCTGTGACTTTGGTATCAGTGGACAGCTGGTGGACTCCATTGCTAAG
ACAAGAGATGCAGGGTGTAGGCCTTACATGGCACCTGAAAGAATAGACCCGAGTGCATCA
CGACAAGGATATGACGTCCACTCTGAAGTCTGGAGTTTGGGGATCACATTGTATGAGTTA
GCCACAGGTGGGTTTCCTTACCCAAAGTGGAACAGTGTGTTCGATCAGCTCATGCAAGTC
GTGAAAGGGGACCCTCCGCAGCTGAGCAACTCCGAAGAATGCAAGTTCTCCCTGAGCTTC
ATCAACTTTGTCAACTTGTGCCTTACGAAGGATGAATCCAAAAGGCCAAAGTATAAAGAC
CTTCTGAAACATCCCTTTATTTTGATGTATGAAGAACGTACCGTCGAGGTTGCCTGCTAT
GTTTGTAAGATCCTGGATCAGATGCCAGTGACTCCCAGCTCTCCCATGTATGTCGAC


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
VHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHL
VHKPSG..MAVKR..STVDEKEQ.QLLM.LDVVM.SSDCPYIVQFYGALFR.GDCWICMELMSTSFDKFYKYVYSV.DDVIPEEILGKITLATVKALNHL
Retrocopy
VHKPSGPMMAVKRVWSTVDEKEQNQLLMNLDVVMQSSDCPYIVQFYGALFRGGDCWICMELMSTSFDKFYKYVYSV*DDVIPEEILGKITLATVKALNHL


Parental protein
KENLKIIHRDIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQ
KENLKIIHRDIKPSNILLD.SGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDV.S.VWSLGITLYELATG.FPYPKWNSVFDQL.Q
Retrocopy
KENLKIIHRDIKPSNILLD-SGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVHSEVWSLGITLYELATGGFPYPKWNSVFDQLMQ


Parental protein
VVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
VVKGDPPQLSNSEE..FS.SFINFVNLCLTKDESKRPKYK.LLKHPFILMYEERTVEVACYVCKILDQMP.TPSSPMYVD
Retrocopy
VVKGDPPQLSNSEECKFSLSFINFVNLCLTKDESKRPKYKDLLKHPFILMYEERTVEVACYVCKILDQMPVTPSSPMYVD


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide