RetrogeneDB ID:
retro_mputfur_1420
Organism:
Location:
GL897124.1:1355360-1355710 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
Alignment summary

Identity:
55.93 %
Coverage:
72.67 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
ACP1
Parental gene aliases:
No gene alias available
Parental gene description:
acid phosphatase 1, soluble [Source:HGNC Symbol;Acc:122]

Genomic region (view in browser)





>retro_mputfur_1420
AGCATCTGTCAATCACTCACTGCAGCAGCGATTTTCAGAGAACTTGTAACTGATCAGAAT
GTTTTGGATACATGGAAAGTAGACAGTGCCACAACATCCAAGCATGAAACAGAAAACCCT
CCTGATTATCAAAGGCACAATGGCATGAAGGGGTACAGTACTGCCATGAATCGCGTTGTC
CAGGCAGGTGACCAAGAAGACTTTGCTACATTTGATTATATTTTATGTATGGAGGAAAGC
AATCTGAAAGATTTGAATAGAAAAAGGAAGCAAGTTAAAAATGGCAAAGCTAAAATTGAA
CCACATGGAGCTATTATCCATGAAAGTGACATATCAGGGAAGATCCCTAT


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
NICRSPIAEAVFRKLVTDQKLSDHWRIDSAATSTYEIGNPPDYRGQSCMKKHGIPMSHTARQVTKEDFATFDYILCMDESNLRDLNRKSNQIKNCKAKIE
.IC.S..A.A.FR.LVTDQ...D.W..DSA.TS..E..NPPDY.....MK.....M.........EDFATFDYILCM.ESNL.DLNRK..Q.KN.KAKIE
Retrocopy
SICQSLTAAAIFRELVTDQNVLDTWKVDSATTSKHETENPPDYQRHNGMKGYSTAMNRVVQAGDQEDFATFDYILCMEESNLKDLNRKRKQVKNGKAKIE


Parental protein
LLG-SYDPQNQLIIEDPY
..G.SY.P....I.EDPY
Retrocopy
PHG/SYYP*K*HIREDPY


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide