RetrogeneDB ID:
retro_mputfur_1428
Organism:
Location:
GL897129.1:1859250-1859675 (-)
Status:
NOVEL
Ensembl ID:
None
Aliases:
No gene alias available
Located in intron of:
None
Alignment summary

Identity:
60.96 %
Coverage:
100.0 %
Frameshifts:
1
Stop codons:
2


Parental gene:
Parental gene symbol:
Rpl26
Parental gene aliases:
No gene alias available
Parental gene description:
ribosomal protein L26 [Source:MGI Symbol;Acc:MGI:106022]

Genomic region (view in browser)





>retro_mputfur_1428
ATGAAGTCCAATCCTTTTATGACTTCTGACCATAGCAAGAACAGAAAAAGTCATTTCAAG
GCACTTTCCCACATTTTCAGGAAGATTATGCCTTTTCCTCTTTCCAAAGAGCTGAGACAG
AACTAGAACGTTCAATCCATGCCCATCCGAAAGGATGAGGAAGTACAGGTTGTGCAAGGA
CACAACAAAGGTCAGCAAACTGGCAAAGGAGTCCAGGTTTACAGGAAGAACTATGTCATC
TACACTGAACAAGTACCTTGCGGGAAGGTGAATGGTCCAACCGTCCATGTGGGCATTCAT
CCTGGCAAGGGGATTGGCACTATTCTATAACTGGACAAAGAGGTCCTGAACATAAAGTCA
AATCTCACCAAGCCCGAAAGGAACAGGGCGAATCAACGGAAGAAACAATTGAAAAAATGC
AGGAA


Parental protein coverage





Changes in the retrocopy sequence






Parental protein
MKFNPFVTSDRSKNRKRHFNAPSHIRRKIMSSPLSKELRQKYNVRSMPIRKDDEVQVVRGHYKGQQIGKVVQVYRKKYVIYIERVQREKANGTTVHVGIH
MK.NPF.TSD.SKNRK.HF.A.SHI.RKIM..PLSKELRQ..NV.SMPIRKD.EVQVV.GH.KGQQ.GK.VQVYRK.YVIY.E.V...K.NG.TVHVGIH
Retrocopy
MKSNPFMTSDHSKNRKSHFKALSHIFRKIMPFPLSKELRQN*NVQSMPIRKDEEVQVVQGHNKGQQTGKGVQVYRKNYVIYTEQVPCGKVNGPTVHVGIH


Parental protein
PSKVVITRLKLDKDRKKILERKAKSRQVGKEKGKYKEETI-EKMQE
P.K...T.L.LDK.....L..K...................EKMQE
Retrocopy
PGKGIGTIL*LDKE---VLNIKSNLTKPERNRANQRKKQL/EKMQE


Legend:
*
Stop codon
\
Forward frameshift by one nucleotide
/
Reverse frameshift by one nucleotide